KEGG   Methanoplanus petrolearius: Mpet_1776Help
Entry
Mpet_1776         CDS       T01312                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mpi  Methanoplanus petrolearius
Brite
Enzymes [BR:mpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Mpet_1776
Transfer RNA biogenesis [BR:mpi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Mpet_1776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1802789..1804414)
Genome map
AA seq 541 aa AA seqDB search
MLRGLVLKRLLLNTKQSKDSIFFLREIISLIKSEAKDQSDIQKIKASVCRKYSLERMPKN
SEIFAAAENDEEKEILRAYLQVKPARTISGVAPVAVMTSPHKCPHGKCLPCPGGPEHPFG
SPQSYTGEEPAALRARQHEYDPYTQVQARLRQFEELGHHVDKAELIVMGGTITARDPEYR
YWFMRSCIRAMNEYGGEDRGDIFSFEELCEENETARVRCIAATFETRPDWCMKEHIDDML
ALGVTKVELGVQQIENRILEYNRRGHGVEATEEANRLLRDAGLKVGFHVMPNLPSATIED
DKKMFDLLFTDERFCPDFLKIYPTLVTPGSEIEELWRSGQYDVYDEDDLIDLVAYGKSKL
PPYVRLQRVQRDIPAKLILRGSHFSNFRQLAKERLESTGGRCRCIRCSEAGRNEISEPPE
IDTIRYRCCGGDEFFIRYVSGESLIGFIRLRFPAEPWREEILDSALVRELHVYGAVVPIA
EKAGPNEWQHRNFGDRLLKEAERVAGEAGYESVGIMSGIGVRPYYRKKGYNRSGPYMVKE
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgctccggggactggtactgaagaggttgctgttgaacactaaacaatccaaagattca
attttttttttaagggagataatctccctgattaaatccgaagcaaaagatcagtctgat
atccagaagatcaaggcttcggtctgcagaaaatattcccttgagcggatgccgaaaaat
tccgagatcttcgcggcagcggagaacgatgaggaaaaagagatcctccgtgcatatcta
caggtaaaacctgcacggacgatctcgggtgtggccccggtggccgtcatgacgtctccg
cacaagtgcccccacgggaaatgcctcccctgtccgggaggaccggagcacccgttcggc
tctccgcagagttataccggggaggagccggccgcccttcgtgccaggcagcacgaatac
gacccttacacccaggtgcaggcgagactgaggcagttcgaggagctcgggcatcacgtc
gacaaggcagaactcatagtaatgggcgggacgataaccgccagggacccggagtacagg
tactggttcatgagatcgtgcatccgtgcgatgaacgaatacggcggggaggaccgcggc
gatatattcagtttcgaagaactttgcgaagagaacgagaccgccagggtccggtgcatt
gcggcgaccttcgagacaaggcccgactggtgcatgaaggagcacatcgacgatatgctc
gccctcggggttacgaaggtcgaacttggcgtccagcagatcgaaaatagaatcctcgag
tacaatcgcaggggtcacggtgtagaggctacggaggaggcgaaccgtctcctgagggat
gcagggctcaaggtcggatttcacgtgatgcccaaccttccttcggcgacgatcgaagac
gacaaaaaaatgttcgacctcctttttacagacgagaggttctgcccggatttcctgaag
atctatcccacccttgtaacgcccggctcggagatcgaggagctgtggcgatccggccaa
tacgatgtctacgacgaggatgacctcatcgacttggttgcatacggtaaatcaaaactc
ccgccgtatgtccgtctccagcgggtccagagggatatccctgcaaaacttattctgcgt
ggatcgcatttcagcaacttccgccagcttgcaaaagagaggcttgaaagcactggcgga
cggtgcaggtgcataagatgcagcgaggcgggacgaaatgagatcagcgaaccccccgag
atcgatacgatcaggtacaggtgctgcggcggcgacgagttcttcatccggtatgtctcg
ggcgaatctctcatcggttttatccgcctgagattccccgccgaaccgtggcgagaggag
attctcgattccgccctcgtccgtgagctccatgtttacggggccgtcgtgcctattgcg
gaaaaggcgggcccgaacgaatggcagcacaggaatttcggggaccgtctcttaaaagaa
gccgagagagtcgcaggcgaagcaggatacgaaagtgtcggtataatgagcggtatcggt
gtacggccttattacaggaaaaaaggatacaatagaagcggcccatatatggttaaggaa
ttataa

DBGET integrated database retrieval system