KEGG   Methanolacinia petrolearia: Mpet_1868Help
Entry
Mpet_1868         CDS       T01312                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mpi  Methanolacinia petrolearia
Pathway
mpi00010  Glycolysis / Gluconeogenesis
mpi00030  Pentose phosphate pathway
mpi00051  Fructose and mannose metabolism
mpi00052  Galactose metabolism
mpi00230  Purine metabolism
mpi00500  Starch and sucrose metabolism
mpi00520  Amino sugar and nucleotide sugar metabolism
mpi00521  Streptomycin biosynthesis
mpi01100  Metabolic pathways
mpi01110  Biosynthesis of secondary metabolites
mpi01120  Microbial metabolism in diverse environments
mpi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_1868
   00030 Pentose phosphate pathway
    Mpet_1868
   00051 Fructose and mannose metabolism
    Mpet_1868
   00052 Galactose metabolism
    Mpet_1868
   00500 Starch and sucrose metabolism
    Mpet_1868
   00520 Amino sugar and nucleotide sugar metabolism
    Mpet_1868
  Nucleotide metabolism
   00230 Purine metabolism
    Mpet_1868
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mpet_1868
Enzymes [BR:mpi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mpet_1868
    5.4.2.8  phosphomannomutase
     Mpet_1868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADN36620
UniProt: E1RIM8
Position
1888795..1890273
Genome map
AA seq 492 aa AA seqDB search
MNIFHPRDLATPTSKIKFESTVVIQISKNRFTFHFISYTGTMASEKAEKKLFGTNGARGV
TGKDMTPDLVMRIGLSLSKIRKGKIAVGMDTRTSGPSLKSAIKAGLLAGGCDVVDLGILP
TPALQYIVKLHFDAGAMITASHNPPEYNGVKIIDSDGTEFSDEDTIKLEGILFSGDYELK
EWTGVGKESCANEMLDEYTDAICSRIEKLEKPLTVAVDPGSGPACLTTEKILTGIGCRVH
TINGQMDGFFPGRMPEPSPEGLKPLAELVLATNSAFGVAHDGDADRAVFIDDKGEYLEEN
EEFALMQKYACRNNPGGVVVTPVSTSKVAEIIAAEYNCRVEYTRVGSISVARKMIELAEK
GENVVFGGEGNGGLIFPGHQHCRDGGMTAAAMASLISTEGRPLSELRKDLPKLVMLKDKI
FSDNHTEILNKATKSFSGEEIDLTDGVRINRKDGRWALLRPSGTEPFMRLYVEAPEKDAA
ESFREEILKSIN
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttttcatccccgggatcttgccacgcctacaagtaaaatcaaatttgaatca
actgttgttatacaaatatccaaaaacagatttaccttccacttcatatcatataccggt
acaatggcttcagaaaaagcagaaaagaaattattcggaacaaacggtgcaagaggggtt
accggaaaggacatgacacccgatcttgtcatgagaatcggtctttcactgagcaaaata
agaaaagggaagattgcagtcggcatggacacccggacttcgggcccctccctgaaatct
gccataaaagccggactgcttgcgggcggatgcgatgtcgtcgacctgggaattttaccc
acgcctgccctgcagtatattgtaaaattacatttcgatgcaggcgccatgattactgca
tcccataatccccctgaatataacggcgttaaaataatcgactcggacggaacggaattc
agcgatgaagatacgataaaacttgaagggatccttttctcgggcgattatgagctcaaa
gaatggacaggagtaggtaaggaatcctgtgcaaacgagatgctcgatgaatacactgat
gctatatgcagccggatcgaaaaacttgaaaaaccgctgaccgttgcagtcgatcccgga
tcgggccccgcatgcctgacgaccgaaaaaattctcaccggaatcggatgcagggttcat
actataaacgggcagatggacggattcttcccggggagaatgcccgaaccctcacccgag
ggtttgaagccccttgcagaacttgtacttgcaacaaattccgctttcggggtagcgcat
gacggagatgcggacagggccgtgttcatagacgacaaaggtgaataccttgaagagaac
gaagaattcgccctcatgcagaaatatgcctgccgcaacaaccccgggggagttgtagta
acgcctgtaagcacttcaaaggttgcagaaattatagcggccgaatacaactgccgtgtc
gagtataccagagtgggaagcatctcagttgcaaggaagatgattgaacttgcagaaaaa
ggggaaaacgtcgtattcggcggagaaggaaacggcggactgatattccccggacaccag
cactgccgtgacggagggatgacggcggcagcaatggcctctttgatctcaacagaagga
agaccactctctgaattaagaaaagatcttcccaaactcgtaatgctcaaggataagata
ttcagcgacaatcataccgaaattctgaataaagcgaccaaatcattttcaggtgaagag
atcgatcttaccgacggagtaagaatcaacagaaaagacggcagatgggctctgctccgc
ccgtccggaacggagccgtttatgagattatatgtagaggcgcctgaaaaagatgcagca
gagtcattcagggaagagatcctgaaatcaataaactaa

DBGET integrated database retrieval system