KEGG   Methanolacinia petrolearia: Mpet_2088Help
Entry
Mpet_2088         CDS       T01312                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpi  Methanolacinia petrolearia
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpet_2088
   01230 Biosynthesis of amino acids
    Mpet_2088
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_2088
   00051 Fructose and mannose metabolism
    Mpet_2088
   00562 Inositol phosphate metabolism
    Mpet_2088
Enzymes [BR:mpi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mpet_2088
Exosome [BR:mpi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mpet_2088
  Exosomal proteins of bladder cancer cells
   Mpet_2088
  Exosomal proteins of melanoma cells
   Mpet_2088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2095218..2095892
Genome map
AA seq 224 aa AA seqDB search
MPEEKPVIMINFKTYNESYGFRAHDIAEAAETVAEESGIEIVICPGFMDIHPMSNHYRLP
VFAQHIDGISPGAHTGHILAEAVRAAGATGTLINHSERRLTLADISAAVDAAKRANLKTV
VCTNNTATSGAAAALSPDYVAIEPPELIGSGISVATADPEIIENSVNAVKSVNKDVKVLA
GAGISSGSCVKRAVELGSDGVLLASGVVKAEDPAVVLRDLVSKI
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagaaaagcccgttataatgataaacttcaagacctacaacgagagttacggt
ttcagggctcatgacattgccgaggcagccgagaccgtagcggaagaaagcggcattgaa
atcgtaatctgtcccggattcatggatatacacccgatgtcaaaccattaccgcctgcct
gtcttcgcccagcatatagacggaatctcgcctggcgcacacacggggcatatccttgcc
gaggcagtaagagcggcgggagctacgggcacgcttatcaaccactcggagagaagactg
actcttgcggatatctccgcggctgtggacgcagcaaaaagagcaaatctgaagaccgta
gtctgtacaaacaacacagcgacgagcggagcggcggcggcactctctcccgactacgtg
gctatcgaaccgccggaactcatcggcagcgggatttcggttgcaacggcagacccggaa
ataatcgaaaattcggtaaatgcggtaaaatcagtcaacaaagatgtcaaagtccttgca
ggtgcgggaatcagttcgggctcgtgtgtcaaaagagctgtcgaactcggctcggacggg
gtactgctcgcatcgggggtcgttaaggccgaagaccccgcagtggtcctgagagacctt
gtctcaaagatctaa

DBGET integrated database retrieval system