KEGG   Methanoplanus petrolearius: Mpet_2088Help
Entry
Mpet_2088         CDS       T01312                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpi  Methanoplanus petrolearius
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpet_2088
   01230 Biosynthesis of amino acids
    Mpet_2088
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_2088
   00051 Fructose and mannose metabolism
    Mpet_2088
   00562 Inositol phosphate metabolism
    Mpet_2088
Enzymes [BR:mpi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mpet_2088
Exosome [BR:mpi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mpet_2088
  Exosomal proteins of bladder cancer cells
   Mpet_2088
  Exosomal proteins of melanoma cells
   Mpet_2088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2095218..2095892
Genome map
AA seq 224 aa AA seqDB search
MPEEKPVIMINFKTYNESYGFRAHDIAEAAETVAEESGIEIVICPGFMDIHPMSNHYRLP
VFAQHIDGISPGAHTGHILAEAVRAAGATGTLINHSERRLTLADISAAVDAAKRANLKTV
VCTNNTATSGAAAALSPDYVAIEPPELIGSGISVATADPEIIENSVNAVKSVNKDVKVLA
GAGISSGSCVKRAVELGSDGVLLASGVVKAEDPAVVLRDLVSKI
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagaaaagcccgttataatgataaacttcaagacctacaacgagagttacggt
ttcagggctcatgacattgccgaggcagccgagaccgtagcggaagaaagcggcattgaa
atcgtaatctgtcccggattcatggatatacacccgatgtcaaaccattaccgcctgcct
gtcttcgcccagcatatagacggaatctcgcctggcgcacacacggggcatatccttgcc
gaggcagtaagagcggcgggagctacgggcacgcttatcaaccactcggagagaagactg
actcttgcggatatctccgcggctgtggacgcagcaaaaagagcaaatctgaagaccgta
gtctgtacaaacaacacagcgacgagcggagcggcggcggcactctctcccgactacgtg
gctatcgaaccgccggaactcatcggcagcgggatttcggttgcaacggcagacccggaa
ataatcgaaaattcggtaaatgcggtaaaatcagtcaacaaagatgtcaaagtccttgca
ggtgcgggaatcagttcgggctcgtgtgtcaaaagagctgtcgaactcggctcggacggg
gtactgctcgcatcgggggtcgttaaggccgaagaccccgcagtggtcctgagagacctt
gtctcaaagatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system