KEGG   Methanoplanus petrolearius: Mpet_2231Help
Entry
Mpet_2231         CDS       T01312                                 

Definition
Magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mpi  Methanoplanus petrolearius
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mpet_2231
Enzymes [BR:mpi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mpet_2231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2238675..2239715
Genome map
AA seq 346 aa AA seqDB search
MSKDNPVYPFSAIVGQEDMKDALLVNVVDPSIGGVLIRGEKGTAKSTAVRATADLLPEKK
VIKDCIFHCEAGQTRYLCPSCRELIESGRVPEYEYTRMRVVELPVSATEDRVAGTLDIEH
AITKGKKKFEPGVLASANGNILYVDEVNLLDDHIVDLLLDAAAMGVNFVEREGISYSHPS
RFILVGTMNPEEGDLRPQLLDRFGLSVNVEGEKEIATRTEIIRRILDFERDPEKFCESYE
PMQQEIRDRIEGAKTILGEIEPDDHLLETAVKISLLLGVDGHRSDITFVKTAVAFAALGG
RDEIVRDDLIRAAGLALPHRTRRLPFEDVKPEFDKVKTVISECYGK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagataacccggtttatcccttctccgccatagtggggcaggaggatatgaaa
gacgcactcctcgtcaatgtagtcgacccttccatagggggagtcctgatccggggtgaa
aaagggactgctaaatcgaccgcagttagggcgacagccgacctgctccccgaaaaaaaa
gtaattaaagactgcatctttcactgcgaagcgggacagaccaggtacctctgcccttca
tgcagggagctgatcgaatccggcagagtccctgaatatgaatacaccaggatgcgtgtc
gtagagcttccggtaagcgcaacggaggatcgggtggcaggaaccctcgacatagaacac
gcgattacaaaaggcaaaaagaagttcgagcccggagttctcgcctccgccaacgggaat
atcctttacgtcgacgaggtgaatctgctcgacgaccatatcgtcgatctacttctcgat
gccgcggcgatgggcgtcaacttcgtcgaacgcgaggggatatcctactcccacccgtca
cggttcatcctcgtcgggaccatgaaccccgaggagggagacctgcggccacagcttcta
gacaggttcggcctctcggtgaacgtcgaaggtgagaaagagatagccacaagaacggag
atcatcaggagaatactggatttcgagagagatccggaaaagttctgtgaatcctatgaa
ccgatgcagcaggagattcgtgatcgtattgaaggagcgaagacgatccttggggagatc
gaacctgacgatcatctacttgagaccgcggtaaagatctctctcctcctcggtgtcgac
gggcacaggtccgatatcacctttgtaaagacagcagtggctttcgccgcactcggcgga
agagatgagatcgtgcgggacgatcttatcagggccgcagggctggcactaccgcacagg
acgagaaggcttccgttcgaagacgtaaaaccggaattcgacaaagtaaaaacggtcatc
tcggagtgttacggcaagtga

DBGET integrated database retrieval system