KEGG   Methanoplanus petrolearius: Mpet_2270Help
Entry
Mpet_2270         CDS       T01312                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mpi  Methanoplanus petrolearius
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpet_2270
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mpet_2270
   00640 Propanoate metabolism
    Mpet_2270
   00660 C5-Branched dibasic acid metabolism
    Mpet_2270
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpet_2270
Enzymes [BR:mpi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mpet_2270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2281824..2282933)
Genome map
AA seq 369 aa AA seqDB search
MKLLEYEAKDIFKKYGIPVAKGFVVKKTDCDGTGGKINSGIKECELGDEVVIKAQVEVGG
RGKAGGVVICPAGDAPEKAAAMFAKDIKGVLVDTILVEEKLPITGEYYVSITLDRSKKAP
VILFSAEGGVEIEETAKNNPGALHRVRVSPMLDDIPDFMMRELVRDAPKELAPVIKSLYR
VFCKSDAILAEINPLVTTGKGVYAADAKIIVDDNALGRQGITVNRDLTERERLAEDLGFS
YVELEGNIGVIGNGAGLTMSTLDMIEYFGGKAANFLDVGGGADRGRVCSAVKLVSGMDGV
KVIVVNLLGGITRCDEVAAGIVEAGVSQQVVVRLAGTNEAEGKKILSEKGYRMLGSMEEV
VKFAVEEAD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttggaatacgaggccaaggatatttttaaaaaatacggaatcccggtagcg
aagggttttgtcgtaaaaaaaaccgactgtgacggaacgggcggaaaaataaattccggg
ataaaagaatgcgaactcggagacgaggtcgtcatcaaggcccaggtggaagtcggcgga
aggggcaaggctggcggggtcgtgatctgtcctgcgggcgatgcacccgagaaagcggcc
gcgatgtttgcaaaggatatcaaaggcgtccttgtcgacacgatcctcgtagaggagaag
ctcccgataacgggcgaatattatgtgagcatcactctcgaccggtccaaaaaggcgcct
gtgatcctcttctcggccgaaggcggagtggagatcgaggagacggcgaagaataatccc
ggtgcactccacagggtcagggtctccccgatgctcgacgatatcccggacttcatgatg
agggagcttgtcagggacgccccgaaggagcttgctcctgtaataaagtcgctctaccgt
gtcttctgcaaaagcgatgctatcctcgctgagatcaacccgcttgtaacgactgggaag
ggagtttatgcggcggatgcgaagatcatcgtcgacgacaacgctctcggcaggcagggg
atcacggtcaatcgcgacctgacggaacgcgagaggctggctgaggatctcggtttctca
tacgtcgagcttgaaggaaacatcggcgttataggaaacggggccggacttacgatgtcc
acccttgatatgatcgagtatttcggcggcaaggctgcgaacttccttgatgtcggcggc
ggagcggaccggggaagggtttgcagtgcagtgaagcttgtctcgggaatggacggcgtg
aaggtcatcgtcgtcaacctcctcggcggaattacgagatgcgacgaggtggccgccggg
atcgttgaggcgggggtctcccagcaggtcgtcgtccgtcttgcaggaacaaacgaggcc
gagggcaaaaagatcctctcggagaaggggtacaggatgctcgggtcgatggaagaggtt
gtaaagttcgcggtagaggaggcggactga

DBGET integrated database retrieval system