KEGG   Methanolacinia petrolearia: Mpet_2395Help
Entry
Mpet_2395         CDS       T01312                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mpi  Methanolacinia petrolearia
Pathway
mpi00340  Histidine metabolism
mpi01100  Metabolic pathways
mpi01110  Biosynthesis of secondary metabolites
mpi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Mpet_2395
Enzymes [BR:mpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mpet_2395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADN37142
UniProt: E1RDV5
Position
complement(2396746..2397993)
Genome map
AA seq 415 aa AA seqDB search
MLKRLDADSWVPGRRASLEDVYPAVNDIIENVKANGDAALFEYAKKFDRCELDSLLVTED
EREDAYEDVDPKIVEYLIEAESRITEFHEYQKKEDLWLRQLHPGITLGIKTTPLNRAGCY
IPGGRASYPSTAIMTVVPARVAGVESICACTPPPANSMTIAALDIAGATEIVRAGGAQAV
AAMALGTESIEPVQKIVGPGNVYVTAAKILLRGNAEIDFPAGPSEICIIADESANPSFIA
ADILAQAEHDPNAACVLVTTSESLADKVSADVKMMAKSAPRAEIIEKALTNSGYIPAADL
KDAVSISDRIAPEHLSIQVSDPLPVLSAVRNAGSIFVGPYTPVACGDYASGTNHVLPTAG
YASVYSGLNVSHFCKTSTVQIIEQEGLEEIGDIVEALAEAEGLFAHSESVKIRRK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaagactcgatgcggacagctgggtgcccgggaggagggcgtctcttgaggat
gtgtatccggcagtcaacgatattattgagaatgtaaaagccaatggtgatgccgctctt
ttcgaatatgcaaaaaaattcgatcgctgcgaactggactctcttcttgtcactgaggac
gagagggaggatgcatacgaggatgtcgacccgaagatagtcgaataccttatcgaagcg
gagtcgaggatcacagagttccatgaataccagaagaaagaggatctatggctgagacag
cttcaccccgggattacgctcggaattaaaacgactcctttgaacagagcgggatgctac
attccgggtgggcgtgcttcttatccgtcgaccgccattatgaccgtagttcctgcaagg
gttgcaggagttgaatctatatgcgcctgcaccccgccccctgcaaattccatgacaatt
gccgcactcgatatcgcaggtgcgaccgagatcgtccgtgccggcggtgcacaggctgtt
gctgcgatggcactcgggacagagtcgatagaaccggtccagaagattgtcgggccggga
aatgtctacgtcactgcagccaagattctcctccggggcaatgcggagatcgactttcct
gcagggccgtccgagatctgcattatcgccgacgagagtgcgaatccgtcattcatcgcg
gcagacattctcgcccaggcggagcacgacccaaatgctgcatgtgttcttgttacaacg
agtgaatctctcgcggacaaggtatcggcagatgtgaaaatgatggcaaagagtgcgccg
agagcagagattatagaaaaagcccttactaattcagggtatatccccgccgcagacctg
aaggatgctgtctcgatctcggatcgtatagcccccgagcacctgtcgatacaggtctca
gaccctctcccggttctctcggcagtacgtaatgcaggctcgatatttgtcggaccgtat
actcctgttgcatgtggtgactatgcatcgggtacaaaccacgttctccctactgcaggc
tacgcctcagtatattccgggttgaatgtttctcatttctgcaagacatccaccgtccag
atcatcgaacaggaaggtcttgaggagataggcgatatagtcgaggcccttgccgaggca
gaaggcctcttcgcacattcggaatctgttaaaatcagaagaaaataa

DBGET integrated database retrieval system