KEGG   Methanolacinia petrolearia: Mpet_2627Help
Entry
Mpet_2627         CDS       T01312                                 

Definition
(RefSeq) acetate/CoA ligase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpi  Methanolacinia petrolearia
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpet_2627
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_2627
   00620 Pyruvate metabolism
    Mpet_2627
   00640 Propanoate metabolism
    Mpet_2627
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpet_2627
   00680 Methane metabolism
    Mpet_2627
Enzymes [BR:mpi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mpet_2627
Lipid biosynthesis proteins [BR:mpi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mpet_2627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2637517..2639481
Genome map
AA seq 654 aa AA seqDB search
MSIRGSTDSVLLFYTINYVEYQRRYDTITSQEKTNLSHGYIPAEEYREMSNLGNYQTAYE
RFLKDPEKFWSEIASELEWFKEWDQILEWNYPNAKWFTGAKCNITHNCLDRHLNTEKRNK
VALIWRGDDGSERIITYRQLFREVCRFANGLKSLGARKGDRICIYMPNTPEQIIAILACA
RIGAVHNVVFAGFGMESLHSRIRDSESRFVITSDASFRRGKRIDLKSIVDRAIVHTSVEK
VIVHRRTRPRTELYSEIEIDFYDLMKERNYFIEPEVMDSEDPLFILYTSGTTGTAKGILH
TCGGYMVGTYYTCKYVLDMKPSDVHWCTADPGWITGHSYIIYGPLLFGTTLLISETTPDY
PDPGVWWDMVEDFGVTILYTAPTAIRMFMRHGEKWPEKYNLDSLRILASVGEPLNPEAFE
WYYKVIGKSRTPIVDTWWQTETGMHMVTTLVGEKMKPGYAGKAIPGVVADVVDKEGNSKK
AGETGILVIKGPWPSMMRSVWGNDERYRQYWTQIKDYYVVGDLAVKDDDGYIQIIGRSDD
VIIIAGHNLGTAEVESALVEHEAVAEAAVIGIPDPVKGNIIKAFVILIDGYSGSEKLANE
LTYHVRMTLGPIAMPAEIKFVESLPKTRSGKIMRRVLKAQEMGEDPGDLSTMEE
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgatacgtggttcgaccgacagtgttttattattttacactattaattatgtagaa
tatcaaaggaggtatgataccataaccagtcaggaaaaaacaaatctcagccatggatat
atccctgcggaagaataccgggaaatgtccaatttgggcaactaccagactgcctatgag
agatttttgaaagatccggaaaaattctggtctgagatagcatcagagcttgaatggttc
aaagaatgggaccagattcttgaatggaactatccgaatgcaaaatggttcacaggtgca
aaatgcaatatcacgcacaactgccttgacaggcacttaaatacagagaaaagaaacaaa
gtggctctcatatggagaggtgatgacggcagcgaaaggatcattacctaccggcagttg
ttcagggaggtatgcaggtttgcaaacggcctgaaaagtctcggcgcccgtaaaggggac
cggatctgcatatacatgccgaatacaccggaacagatcattgcaatacttgcatgcgca
agaataggcgcggtccacaacgttgtatttgccggattcgggatggagtcactgcattca
aggatcagggattcggaatcgagatttgtcattacatccgatgccagtttcaggagaggc
aaaagaatcgatctcaaatcgatagttgacagggcgatagtccacacatcggttgaaaag
gtcatcgtccacaggcggaccaggccacggaccgaactctactctgaaattgagatcgat
ttctacgatctcatgaaggagaggaattacttcatcgaacccgaggtcatggactccgaa
gacccgctgtttattctctatacaagcggaacgacaggcacggcaaagggtatccttcat
acctgcggcggctacatggtcggaacatattacacatgcaagtatgtcctcgatatgaaa
cccagcgatgtccactggtgtactgccgatcccggatggattacaggacacagctacatc
atatacggccccctgctgttcggaacaaccctgcttatcagcgagacaacaccagactat
cccgatccgggagtctggtgggatatggtagaggacttcggcgtcacgatcctctataca
gcaccgactgcaatcaggatgttcatgagacacggtgagaagtggcctgaaaaatataat
ctcgactccctgaggatactcgcatctgtcggggaaccgctcaatcccgaggcattcgaa
tggtattacaaagttatcgggaagagcaggacgccgatcgtcgatacatggtggcagacc
gaaaccggaatgcacatggtcacaacactcgtcggcgaaaagatgaaacccggatatgca
ggaaaagcgatccccggcgttgtcgccgatgtcgttgacaaagaaggaaattcaaagaag
gcaggagaaacaggcattctcgtcataaaagggccgtggccttcgatgatgagaagcgta
tggggtaatgatgaaagatacaggcaatactggacgcagataaaggactattatgtagta
ggcgatcttgcggtaaaggacgatgacggatatatccagatcataggaagatctgacgac
gtcataataatcgcaggccacaacctcggcactgcagaggtcgaatccgctcttgtagag
catgaggctgttgccgaagccgccgttatcggcattccggaccctgtaaaaggcaacatc
atcaaggccttcgtaatcctgatcgacggatacagcgggagtgaaaagcttgcgaacgaa
cttacataccatgtaaggatgacgctcggccctattgcaatgccggccgagattaaattc
gtcgaatctcttccgaaaacaaggagcggaaagatcatgagacgtgtcctcaaggcccag
gagatgggagaggacccgggtgatctctccacaatggaagaataa

DBGET integrated database retrieval system