KEGG   Methanoplanus petrolearius: Mpet_2663Help
Entry
Mpet_2663         CDS       T01312                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mpi  Methanoplanus petrolearius
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpet_2663
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_2663
   00020 Citrate cycle (TCA cycle)
    Mpet_2663
   00620 Pyruvate metabolism
    Mpet_2663
   00640 Propanoate metabolism
    Mpet_2663
   00650 Butanoate metabolism
    Mpet_2663
  Energy metabolism
   00680 Methane metabolism
    Mpet_2663
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mpet_2663
Enzymes [BR:mpi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mpet_2663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2679169..2679711
Genome map
AA seq 180 aa AA seqDB search
MRELRIHGRGGQGSVTAAELIATAAFKSKIYSQAFPAFGVERRGAPVQAFVRFDDKKIRL
RSQIYEPDYIIVQDSTLIGDVNVFSGMKEGGIAIINTEKEIDGGVPEGVKVVKINATSIA
LETLGLPIENTTLMGAFAAATGEIEFDALEESLRERFPGALADKNIAAARKAYDIVKGGA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
ttgagagaacttcgtatacacggaagaggcggacaaggttcggtcactgctgccgaactc
attgctacagcggcctttaagagtaaaatctactcgcaggccttcccggcatttggagtt
gaaagaagaggagctccggtgcaggcatttgtccgttttgatgataagaagatcaggctt
aggagccagatctatgaaccggattatatcatcgtccaggacagcacattgatcggcgat
gtgaacgtcttcagcggaatgaaagaaggcggaatagcaataatcaatactgaaaaggag
atcgatggcggagtaccggaaggagttaaagtggtaaagatcaacgcgacatcgatcgcg
ctggagacacttggccttcctatcgagaacacaactctcatgggcgcattcgcagcggca
acaggggagatcgagttcgatgcccttgaggaatcgctccgcgagagattcccgggagcg
cttgcagataagaatatcgcagcagccagaaaggcatatgatatcgtaaaaggaggcgcc
tga

DBGET integrated database retrieval system