KEGG   Methanolacinia petrolearia: Mpet_2664Help
Entry
Mpet_2664         CDS       T01312                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mpi  Methanolacinia petrolearia
Pathway
mpi00010  Glycolysis / Gluconeogenesis
mpi00020  Citrate cycle (TCA cycle)
mpi00620  Pyruvate metabolism
mpi00633  Nitrotoluene degradation
mpi00640  Propanoate metabolism
mpi00650  Butanoate metabolism
mpi00680  Methane metabolism
mpi00720  Carbon fixation pathways in prokaryotes
mpi01100  Metabolic pathways
mpi01120  Microbial metabolism in diverse environments
mpi01130  Biosynthesis of antibiotics
mpi01200  Carbon metabolism
Module
mpi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mpi_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_2664
   00020 Citrate cycle (TCA cycle)
    Mpet_2664
   00620 Pyruvate metabolism
    Mpet_2664
   00640 Propanoate metabolism
    Mpet_2664
   00650 Butanoate metabolism
    Mpet_2664
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpet_2664
   00680 Methane metabolism
    Mpet_2664
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mpet_2664
Enzymes [BR:mpi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mpet_2664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_2 Fer4_21 Fer4_7 Fer4_16 Fer4_10 Fer4_9 Fer4_15 Fer4_13 Fer4_17 Fer4_22 Fer4_8 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADN37407
UniProt: E1RG93
Position
2679714..2679974
Genome map
AA seq 86 aa AA seqDB search
MPLNVGCSARPGNARDNKTGSWRTFRPEFDNDKCNTCGTCMMICPEVCIGEDEEGYPDVD
YDFCKGCGLCAEECPKEAIKMKKEEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttaacgtaggctgttccgcaaggcccggaaacgcaagggacaacaaaacaggt
tcgtggagaacattcaggccagagttcgacaacgacaaatgcaacacatgcggaacctgc
atgatgatctgccccgaggtctgtatcggcgaggatgaagaaggatacccggatgtcgac
tacgatttctgcaaaggctgcggcctgtgcgccgaagaatgccccaaagaggcaatcaag
atgaaaaaggaggaaaaatag

DBGET integrated database retrieval system