KEGG   Methanoplanus petrolearius: Mpet_2664Help
Entry
Mpet_2664         CDS       T01312                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mpi  Methanoplanus petrolearius
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpet_2664
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_2664
   00020 Citrate cycle (TCA cycle)
    Mpet_2664
   00620 Pyruvate metabolism
    Mpet_2664
   00640 Propanoate metabolism
    Mpet_2664
   00650 Butanoate metabolism
    Mpet_2664
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpet_2664
   00680 Methane metabolism
    Mpet_2664
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mpet_2664
Enzymes [BR:mpi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mpet_2664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2679714..2679974
Genome map
AA seq 86 aa AA seqDB search
MPLNVGCSARPGNARDNKTGSWRTFRPEFDNDKCNTCGTCMMICPEVCIGEDEEGYPDVD
YDFCKGCGLCAEECPKEAIKMKKEEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttaacgtaggctgttccgcaaggcccggaaacgcaagggacaacaaaacaggt
tcgtggagaacattcaggccagagttcgacaacgacaaatgcaacacatgcggaacctgc
atgatgatctgccccgaggtctgtatcggcgaggatgaagaaggatacccggatgtcgac
tacgatttctgcaaaggctgcggcctgtgcgccgaagaatgccccaaagaggcaatcaag
atgaaaaaggaggaaaaatag

DBGET integrated database retrieval system