KEGG   Methanolacinia petrolearia: Mpet_2678Help
Entry
Mpet_2678         CDS       T01312                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mpi  Methanolacinia petrolearia
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpet_2678
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpet_2678
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mpet_2678
Enzymes [BR:mpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mpet_2678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2690414..2691616)
Genome map
AA seq 400 aa AA seqDB search
MFRLVCINCGAEYNQNEVIYRCGKCGHLLAVEYDFDTIDVSRREWDSRPLKLWRYKELLP
VSREPVTLQEGGTPLYHLKTIGEELGLKELYAKHEGMNPSGSFKDRGMTVGVSMALQLGM
KTVACASTGNTSASLAQYAAKAGIPSVVLLPAGKVALGKVAQALMHGAKVIAIRGNFDRA
LEMVHDLCIKEGLYLLNSVNPYRLEGQKTIGFEAIDQLGGVPDRMVLPVGNAGNISAVHK
GLGELIKLGFIDSMPMMTGVQAEGSRPVADAISKKLPEVIPDKNPETIATAIRIGAPVNA
EKALRAIRETNGTALSVTDEEILAMQRDLARKEGVGVEPASAASVAGIKKMAEEGLLDKD
ERIVCVVTGHLLKDPETVIRQCEPPTEIDADLESLLSVLR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtcttgtctgtataaactgcggtgcagaatacaaccagaacgaggtaatttac
cgctgtggcaagtgcggacaccttcttgcggtcgaatatgatttcgacacgatagatgtc
tcgcgccgggaatgggactcgcgcccgctgaagctctggcgctataaggaactcctgcct
gtaagcagggagcctgttaccctccaggagggcggaactccgctctatcacctgaaaaca
ataggcgaagaactcggattaaaggagctctatgccaagcacgagggcatgaacccgtcc
ggttcgttcaaggaccgcgggatgaccgtcggggtctcgatggcgctccagctcgggatg
aagaccgtcgcctgtgcaagcacgggaaatacgtcggcgagccttgcacagtatgcggca
aaggccgggataccgtcagtcgtgctccttcctgcgggaaaggttgcgctcggaaaggtt
gcccaggcgcttatgcacggtgcaaaggtaattgcaatacgcggaaacttcgacagggcg
cttgagatggtccatgacctctgcatcaaggaaggtctctatcttctcaattcggtcaac
ccttaccgtcttgaaggccagaagaccatcggtttcgaggccatagaccagttaggagga
gttccggacaggatggttcttccggtaggaaacgcaggcaacatatctgcggttcacaag
ggtctcggggagcttataaagctcggattcatcgactcgatgccgatgatgaccggtgtc
caggccgaaggttcgaggccggttgcagatgcaatctcgaagaagcttccggaagtcata
cctgacaagaatcccgagaccatcgcaacggccataaggatcggtgcgcccgtaaatgcc
gaaaaggctcttcgtgctataagggagaccaacggaaccgctctttccgttactgatgag
gagattcttgcgatgcagagagatctcgcaagaaaggagggtgtaggtgtggagcccgca
tctgccgcttctgttgcaggcattaaaaaaatggctgaggaaggtcttttggataaggac
gagagaatagtctgtgtagtaacgggtcaccttttaaaggacccggagacggtgatcagg
caatgcgaacctccgacagagatagacgcggatctcgaatccttgctctctgtgttgcgt
taa

DBGET integrated database retrieval system