KEGG   Methanoplanus petrolearius: Mpet_2678Help
Entry
Mpet_2678         CDS       T01312                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mpi  Methanoplanus petrolearius
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mpi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mpi00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mpi00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2690414..2691616)
Genome map
AA seq 400 aa AA seqDB search
MFRLVCINCGAEYNQNEVIYRCGKCGHLLAVEYDFDTIDVSRREWDSRPLKLWRYKELLP
VSREPVTLQEGGTPLYHLKTIGEELGLKELYAKHEGMNPSGSFKDRGMTVGVSMALQLGM
KTVACASTGNTSASLAQYAAKAGIPSVVLLPAGKVALGKVAQALMHGAKVIAIRGNFDRA
LEMVHDLCIKEGLYLLNSVNPYRLEGQKTIGFEAIDQLGGVPDRMVLPVGNAGNISAVHK
GLGELIKLGFIDSMPMMTGVQAEGSRPVADAISKKLPEVIPDKNPETIATAIRIGAPVNA
EKALRAIRETNGTALSVTDEEILAMQRDLARKEGVGVEPASAASVAGIKKMAEEGLLDKD
ERIVCVVTGHLLKDPETVIRQCEPPTEIDADLESLLSVLR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtcttgtctgtataaactgcggtgcagaatacaaccagaacgaggtaatttac
cgctgtggcaagtgcggacaccttcttgcggtcgaatatgatttcgacacgatagatgtc
tcgcgccgggaatgggactcgcgcccgctgaagctctggcgctataaggaactcctgcct
gtaagcagggagcctgttaccctccaggagggcggaactccgctctatcacctgaaaaca
ataggcgaagaactcggattaaaggagctctatgccaagcacgagggcatgaacccgtcc
ggttcgttcaaggaccgcgggatgaccgtcggggtctcgatggcgctccagctcgggatg
aagaccgtcgcctgtgcaagcacgggaaatacgtcggcgagccttgcacagtatgcggca
aaggccgggataccgtcagtcgtgctccttcctgcgggaaaggttgcgctcggaaaggtt
gcccaggcgcttatgcacggtgcaaaggtaattgcaatacgcggaaacttcgacagggcg
cttgagatggtccatgacctctgcatcaaggaaggtctctatcttctcaattcggtcaac
ccttaccgtcttgaaggccagaagaccatcggtttcgaggccatagaccagttaggagga
gttccggacaggatggttcttccggtaggaaacgcaggcaacatatctgcggttcacaag
ggtctcggggagcttataaagctcggattcatcgactcgatgccgatgatgaccggtgtc
caggccgaaggttcgaggccggttgcagatgcaatctcgaagaagcttccggaagtcata
cctgacaagaatcccgagaccatcgcaacggccataaggatcggtgcgcccgtaaatgcc
gaaaaggctcttcgtgctataagggagaccaacggaaccgctctttccgttactgatgag
gagattcttgcgatgcagagagatctcgcaagaaaggagggtgtaggtgtggagcccgca
tctgccgcttctgttgcaggcattaaaaaaatggctgaggaaggtcttttggataaggac
gagagaatagtctgtgtagtaacgggtcaccttttaaaggacccggagacggtgatcagg
caatgcgaacctccgacagagatagacgcggatctcgaatccttgctctctgtgttgcgt
taa

DBGET integrated database retrieval system