KEGG   Methanoplanus petrolearius: Mpet_2733Help
Entry
Mpet_2733         CDS       T01312                                 

Definition
phosphoglycerate mutase 1 family (EC:5.4.2.4 5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mpi  Methanoplanus petrolearius
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpet_2733
   01230 Biosynthesis of amino acids
    Mpet_2733
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_2733
  Energy metabolism
   00680 Methane metabolism
    Mpet_2733
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpet_2733
Enzymes [BR:mpi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mpet_2733
Exosome [BR:mpi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mpet_2733
  Exosomal proteins of melanoma cells
   Mpet_2733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2742946..2743692)
Genome map
AA seq 248 aa AA seqDB search
MYILILLRHGESTWNRENRFTGWTDVDLSEKGLDEAHNAGKLLRAGGYTFDVAYTSVLKR
AIRTLWITLDEMDLMWIPVSRSWRLNERHYGALQGLNKSETAAKYGDEQVFIWRRSYDIP
PPALDEEDERNPKKDPRYGDLRPEEYPLTECLKDTVARFLPYWNEEIAPAIKSGKRVLIA
AHGNSLRALVKHLDNIADDEIPKLNIPTAVPLVYELDENLRPIRHYYLGDQAEIEAAIKS
VEKQGKSK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtatatactaatactgctccgtcatggcgagagcacatggaacagggaaaaccgtttc
accggatggaccgatgtcgatctgtcggaaaaagggcttgatgaggcccataatgccgga
aaactgcttagggccggggggtatacgttcgatgttgcgtatacctcggttctcaaaagg
gcgatccggacattatggataactcttgacgagatggacctgatgtggattcccgtttcg
cgatcatggaggctcaacgagcgtcattacggggccctgcaggggcttaataaatcggag
accgcggcaaaatacggggacgaacaggtttttatctggcggagaagttatgatatccct
ccgcctgctctcgacgaggaggatgagagaaacccaaaaaaagatcccaggtacggagat
ctcaggccagaggaatatccccttacggaatgcctgaaggatactgttgcgagatttctt
ccttactggaacgaagagattgctcctgcgattaaatccggtaaaagagtccttatagcg
gcacacggaaacagccttcgtgcactagtcaagcatctcgataatatcgcggacgatgag
attcccaagctgaatataccaactgcagttccccttgtctatgaacttgatgaaaacctc
agacctatacgccattattatcttggcgaccaggcagagattgaagccgcaataaaatct
gtagaaaagcagggcaaatcaaaataa

DBGET integrated database retrieval system