KEGG   Methanolacinia petrolearia: Mpet_2733Help
Entry
Mpet_2733         CDS       T01312                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family (EC:5.4.2.4 5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mpi  Methanolacinia petrolearia
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpet_2733
   01230 Biosynthesis of amino acids
    Mpet_2733
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_2733
  Energy metabolism
   00680 Methane metabolism
    Mpet_2733
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpet_2733
Enzymes [BR:mpi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mpet_2733
Exosome [BR:mpi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mpet_2733
  Exosomal proteins of melanoma cells
   Mpet_2733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2742946..2743692)
Genome map
AA seq 248 aa AA seqDB search
MYILILLRHGESTWNRENRFTGWTDVDLSEKGLDEAHNAGKLLRAGGYTFDVAYTSVLKR
AIRTLWITLDEMDLMWIPVSRSWRLNERHYGALQGLNKSETAAKYGDEQVFIWRRSYDIP
PPALDEEDERNPKKDPRYGDLRPEEYPLTECLKDTVARFLPYWNEEIAPAIKSGKRVLIA
AHGNSLRALVKHLDNIADDEIPKLNIPTAVPLVYELDENLRPIRHYYLGDQAEIEAAIKS
VEKQGKSK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtatatactaatactgctccgtcatggcgagagcacatggaacagggaaaaccgtttc
accggatggaccgatgtcgatctgtcggaaaaagggcttgatgaggcccataatgccgga
aaactgcttagggccggggggtatacgttcgatgttgcgtatacctcggttctcaaaagg
gcgatccggacattatggataactcttgacgagatggacctgatgtggattcccgtttcg
cgatcatggaggctcaacgagcgtcattacggggccctgcaggggcttaataaatcggag
accgcggcaaaatacggggacgaacaggtttttatctggcggagaagttatgatatccct
ccgcctgctctcgacgaggaggatgagagaaacccaaaaaaagatcccaggtacggagat
ctcaggccagaggaatatccccttacggaatgcctgaaggatactgttgcgagatttctt
ccttactggaacgaagagattgctcctgcgattaaatccggtaaaagagtccttatagcg
gcacacggaaacagccttcgtgcactagtcaagcatctcgataatatcgcggacgatgag
attcccaagctgaatataccaactgcagttccccttgtctatgaacttgatgaaaacctc
agacctatacgccattattatcttggcgaccaggcagagattgaagccgcaataaaatct
gtagaaaagcagggcaaatcaaaataa

DBGET integrated database retrieval system