KEGG   Mycoplasma pneumoniae FH: MPNE_0278Help
Entry
MPNE_0278         CDS       T01926                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mpj  Mycoplasma pneumoniae FH
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mpj00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296077..296646
Genome map
AA seq 189 aa AA seqDB search
MVDTGRIFVITGPSGVGKSSLVRCLIDHFKDKLRYSISATTRKMRNSETEGVDYFFKDKA
EFEKLIAADAFVEWAMYNDNYYGTLKSQAEQIIHNGGNLVLEIEYQGALQVKQKYPNDVV
LIFIKPPSMEELLVRLKKRNDEDAITIQNRLKQAEKECQQIGHFKYVVTNNEFDKTLAEL
QAILLAEFN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatacagggagaatttttgtcattaccggaccgagcggtgttggcaaaagtagc
cttgttagatgtttaattgaccatttcaaagataaactgcgctacagcatttccgctacc
acccgtaaaatgcgtaacagcgaaactgagggtgtggattacttctttaaagataaagcg
gagtttgaaaaactgattgctgctgatgcctttgtggagtgagcgatgtataacgataac
tactatggtacccttaaatcccaagctgaacaaattattcacaacggtggcaacttggtg
ttagaaattgaatatcaaggtgctttacaagttaagcaaaagtatcccaatgatgtggtg
ctaatttttattaaaccaccttcaatggaagagttgttagtgcgcttaaagaagcgtaat
gacgaggatgcaataacaattcaaaaccgattgaaacaagctgagaaggaatgtcaacaa
attggtcactttaagtatgtggttaccaacaacgagtttgacaagaccttagcggagtta
caagcaattttactagctgaatttaattaa

DBGET integrated database retrieval system