KEGG   Mycoplasma pneumoniae FH: MPNE_0344Help
Entry
MPNE_0344         CDS       T01926                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mpj  Mycoplasma pneumoniae FH
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:mpj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPNE_0344
   01230 Biosynthesis of amino acids
    MPNE_0344
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPNE_0344
   00030 Pentose phosphate pathway
    MPNE_0344
   00051 Fructose and mannose metabolism
    MPNE_0344
   00052 Galactose metabolism
    MPNE_0344
  Energy metabolism
   00680 Methane metabolism
    MPNE_0344
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MPNE_0344
Enzymes [BR:mpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MPNE_0344
Protein phosphatases and associated proteins [BR:mpj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MPNE_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
354003..354989
Genome map
AA seq 328 aa AA seqDB search
MSPKTTKKIAILTSGGDAPGMNATLVYLTRYATSSEIEVFFVKNGYYGLYHDELVPAHQL
DLSNSLFSAGTVIGSKRFVEFKELKVREQAAQNLKKRQIDYLVVIGGDGSYMGAKLLSEL
GVNCYCLPGTIDNDINSSEFTIGFLTALESIKVNVQAVYHTTKSHERVAIVEVMGRHCGD
LAIFGALATNADFVVTPSNKMDLKQLESAVKKILQHQNHCVVIVSENIYGFDGYPSLTAI
KQHFDANNMKCNLVSLGHTQRGFAPTSLELVQISLMAQHTINLIGQNKVNQVIGNKANVP
VNYDFDQAFNMPPVDRSALIAVINKNII
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtccaaaaacaaccaaaaaaattgccattttaacctctggtggtgatgctccaggg
atgaatgccacactagtttacctaacgcgttatgccactagttctgaaattgaagttttc
tttgtgaaaaacggttattatgggctgtaccatgatgagttagtacccgctcatcaatta
gatttgtcaaacagcttgtttagtgctggcaccgtgattggtagtaagcgctttgtcgaa
tttaaggagttaaaggtccgcgagcaagcagcacagaatcttaaaaagcgccaaatcgat
tacctagtggttattggtggtgatggtagttacatgggcgctaaattgctaagcgagttg
ggcgttaactgttactgtttgccgggtacgattgacaacgacataaattcgagtgagttt
acaattggttttctcacggctttggagtcgattaaggtcaatgtccaggccgtgtaccac
actacgaaatcacatgaacgggtcgccattgtggaggtgatgggtcgccattgtggtgat
ttagccatttttggtgccttagccaccaatgctgactttgtggtgactcctagcaataaa
atggatttaaagcagctagaaagtgctgtcaaaaagatcttgcaacaccaaaaccactgt
gtggtgattgttagtgaaaacatctatggctttgatggttatccctcacttacagcgatc
aaacagcactttgatgctaacaacatgaagtgtaacctggtgtccttgggtcacacgcaa
cgcggatttgcccctaccagcctcgagttagtccaaattagtttaatggcgcaacacacg
attaacttaattggacaaaacaaggttaaccaggtcattggtaataaggccaatgtgccc
gttaactatgactttgatcaagcctttaacatgccaccggttgatcgcagcgctttaatt
gcagtcattaataaaaatattatttaa

DBGET integrated database retrieval system