KEGG   Mycoplasma pneumoniae FH: MPNE_0374Help
Entry
MPNE_0374         CDS       T01926                                 

Gene name
folA_2
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mpj  Mycoplasma pneumoniae FH
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mpj00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mpj00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
379851..380333
Genome map
AA seq 160 aa AA seqDB search
MVKAIWAMDQNGLIGNGNSLPWRIKAELQHFRQTTLHQDVLMGSATYLSLPPVFSERNVY
ILTRNLNFNPPDKGCLTKVIHEYENFIQPYLHHPDKHLYICGGAQVYEQLIPRCDALIVS
TIFGKYTGDKYLKVDFSPFELTKEISFAEFKVAYYHKIAR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagcaatttgagcaatggatcaaaatgggttaattggtaacggtaacagtttg
ccctgaaggattaaagcggagttacagcactttcgccagaccacgttgcaccaagatgta
ttaatgggctcggctacctatctttccttaccgccggtgtttagtgagcgtaacgtttat
atcctcacccgtaacctcaactttaacccgcctgataagggctgtttgactaaagtaatc
catgaatatgaaaactttatccaaccttatttgcaccatcccgataaacacctctacatc
tgtggtggggcacaagtttatgaacagctcattccccggtgtgatgcgttaattgtctct
accattttcggtaaatacaccggggacaaatacctcaaagtggattttagtccctttgaa
ttgaccaaagagatcagttttgctgagtttaaggtcgcttactatcacaaaattgcacga
taa

DBGET integrated database retrieval system