KEGG   Mycoplasma pneumoniae FH: MPNE_0453Help
Entry
MPNE_0453         CDS       T01926                                 

Definition
(GenBank) putative dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mpj  Mycoplasma pneumoniae FH
Pathway
mpj00010  Glycolysis / Gluconeogenesis
mpj00020  Citrate cycle (TCA cycle)
mpj00620  Pyruvate metabolism
mpj01100  Metabolic pathways
mpj01110  Biosynthesis of secondary metabolites
mpj01120  Microbial metabolism in diverse environments
mpj01130  Biosynthesis of antibiotics
mpj01200  Carbon metabolism
Module
mpj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPNE_0453
   00020 Citrate cycle (TCA cycle)
    MPNE_0453
   00620 Pyruvate metabolism
    MPNE_0453
Enzymes [BR:mpj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MPNE_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: ADK87254
UniProt: A0A0H3DQ17
Position
complement(465991..467199)
Genome map
AA seq 402 aa AA seqDB search
MANEFKFTDVGEGLHEGKVTEILKKVGDTIKVDEALFVVETDKVTTELPSPYAGVITAIT
TNVGDVVHIGQVMAVIDDGAGAAAPAAPQPVSAPAPAPTPTFTPTPAPVTTEPVVEEAGA
SVVGEIKVSNSVFPIFGVQPSAPQPTPAPVVQPTSAPTPTPAPASAAAPSGEETIAITTM
RKAIAEAMVKSHENIPATILTFYVNATKLKQYRESVNGLALSKYNMKISFFAFFVKAIVN
ALKKFPVFNGRYDKERNLIVLNKDVNVGIAVDTPDGLIVPNIKQAQTKSVVDIAKDIVDL
ANRARSKQIKLPDLSKGTISVTNFGSLGAAFGTPIIKHPEMCIVATGNMEERVVRAEGGV
AVHTILPLTIAADHRWVDGADVGRFGKEIAKQIEELIDLEVA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgagtttaagttcaccgatgttggtgagggcttacatgagggtaaagtaact
gaaatcctcaaaaaagtgggcgatacgatcaaggtcgatgaagccctttttgtagtggaa
accgataaggtaaccaccgaacttccatccccttatgctggggttattaccgccattacc
actaatgttggtgatgtggtgcacattggtcaggtgatggccgttattgatgatggcgct
ggtgctgctgcacctgctgcgccccaaccagtatctgcaccagctcctgccccaacccca
acatttaccccaacaccagcacctgtaaccaccgaaccagtagtggaagaggcgggtgcc
tcggtagtgggtgaaattaaggtatcgaacagtgtgtttcctatttttggtgtgcagcca
agtgcgccccaaccaacaccagctcctgtagtacaacctacatccgctccaactcccact
ccagctccagcatctgcagcagcacctagtggtgaggaaacgattgcgatcacgacaatg
cgtaaagcaattgctgaagcaatggtgaaatcacacgaaaacattcccgctacgattctc
accttctatgttaacgctactaagttaaagcagtaccgtgagagtgttaacggcttagct
ttaagcaagtacaacatgaagatttccttctttgctttctttgttaaagcaattgttaat
gctttgaagaagtttcctgttttcaatggtcgttatgacaaggaacgcaacctaattgtg
ttaaacaaggatgttaacgtaggtattgccgtggacactcccgatggtctgattgtgcct
aacattaagcaagcacaaacgaagtcggtagtcgacattgccaaggacattgttgatctt
gctaaccgtgcccgcagtaagcaaattaagcttcctgatttaagtaagggaacgatctcg
gtaactaactttggttctttaggcgctgcttttggtaccccgattattaagcacccggaa
atgtgtattgtcgctaccggtaacatggaagaacgtgttgtgcgtgctgaaggtggggta
gccgttcataccatcctaccgttaacaattgctgccgaccaccgctgggtcgatggcgct
gatgtgggtcgctttggtaaggaaattgccaagcaaatcgaagaattaattgatttagaa
gtagcttag

DBGET integrated database retrieval system