KEGG   Candidatus Methanosphaerula palustris: Mpal_0215Help
Entry
Mpal_0215         CDS       T00823                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
mpl00260  Glycine, serine and threonine metabolism
mpl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mpl01100  Metabolic pathways
mpl01110  Biosynthesis of secondary metabolites
mpl01130  Biosynthesis of antibiotics
mpl01230  Biosynthesis of amino acids
Module
mpl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpal_0215
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpal_0215
Enzymes [BR:mpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mpal_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACL15601
JGI: Mpal0215
UniProt: B8GJ28
Position
complement(247604..248779)
Genome map
AA seq 391 aa AA seqDB search
MDNGRFGEFGGRYVPETMIAALDELEAAYIRARNDPAFVTALRQMLTEYAGRPTQLTFCP
RMSADLGCKVYLKREDLMHGGAHKLNNTLGQGLLAKSMGKTRLIAETGAGQHGVATAIVG
AVLGMPVQVYMGEVDIERQQLNVFRMQLMGAEVIPAKTGTRTLKDAVNEALRGWVSELDT
THYVLGSVVGPHPYPTMVRDFQAVIGNETREQFLSRYGRLPDMAIACVGGGSNAIGMFHP
FVNDPSVRLVGVEAGGKGTGPGEHGATLCRGTPGVLHGALSYLLQDEDGQIEETHSIAAG
LDYPGVGPEHSMHRETGRIEYTSVTDDEALAAFRYLSRMEGIIPALESAHAVAHARKVAK
ELGPDQSMVITLSGRGDKDLAQIAKMGGIAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggataacggaagatttggagaatttggagggcgatatgtccctgagacgatgatcgcg
gcactcgatgaacttgaggcggcttacatcagggcccggaacgacccggcctttgtcacg
gcactcaggcagatgctgaccgagtacgccgggaggccgacccagctcaccttctgcccg
cggatgtcggcggatctcggctgtaaggtctacctgaaacgggaggacctgatgcacggt
ggggcacacaaactgaacaacaccctcggccaggggctgctcgcaaagtccatgggcaag
acacggctgatagccgagacaggggccgggcagcacggggtcgcgacggccatcgttggt
gcagtacttgggatgccagtacaggtctatatgggcgaggtcgatatcgaacggcaacag
ttgaacgtctttcggatgcagttgatgggggccgaggtgatcccggcaaaaaccggaacc
agaaccctgaaggatgcagtcaacgaggcgctgcggggatgggtcagcgaactggacacc
acccactatgtcctcggctcggtagtcggaccccacccatatccgacgatggtccgggac
ttccaggcggtgatcgggaacgagacccgcgaacagttcctctcccgctacggccggctg
ccggatatggccatcgcctgcgtcggcggcggctcgaacgcaatcgggatgttccacccg
ttcgtgaacgacccatcggtcagattggttggtgtcgaggccggtggcaaggggaccggg
ccaggagaacacggggccaccctctgcagggggacaccgggggtgctccatggggcactc
tcgtacctgctgcaggacgaagacggacagatcgaggagacccactcgatcgcagccggt
ctggattacccaggtgtcggtcccgaacacagcatgcacagggagaccggcaggatcgag
tacacctctgtgaccgatgacgaggcgctggccgcgttccggtacctctcccggatggag
gggatcattcccgctctcgaatccgcccatgcggtcgcgcatgcccggaaggtagcgaag
gagctcggaccagatcagagcatggtgatcaccctctccggccgtggggacaaggacctg
gcccagatcgcaaagatggggggtatcgccttatga

DBGET integrated database retrieval system