KEGG   Candidatus Methanosphaerula palustris: Mpal_0491Help
Entry
Mpal_0491         CDS       T00823                                 

Definition
(RefSeq) acetate/CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpal_0491
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpal_0491
   00620 Pyruvate metabolism
    Mpal_0491
   00640 Propanoate metabolism
    Mpal_0491
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpal_0491
   00680 Methane metabolism
    Mpal_0491
Enzymes [BR:mpl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mpal_0491
Lipid biosynthesis proteins [BR:mpl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mpal_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
498179..500086
Genome map
AA seq 635 aa AA seqDB search
MHEIKESFDVKLAEDEKYYVPDEKYRRTSWIGDYQRRYDEFLADPDAFWNDIAEELDWVR
HWDRVLEWNYPYAKWFVNARLNITSNCLDRHVASDRRNKAALIWRGEDGTERVYTYQKLL
TEVIHFANGLKKVGVSKGDRVCIYMPMVPEQAIAMLACARIGAVHSVVFAGFGETALNMR
ITDAQAKIVITADISIRRGKAIPLITIVKEAILNAPSVEHLVILRRRREPPVEMRPDFEL
DFYELMRNGGADCPPEAMDAEDPLFMLYTSGSTGTPKGVVHTCGGYMVGTYYTSKYVFDL
KENDIYWCTADPGWITGHSYIVYGPLIVGATVFISEMTLDYPDPGIWWRLIEEQRINIFY
TAPTAIRTFMKLGEAWPEKYDLSSLRIIGSVGEPLNPEAFEWYYHVIGKDRCPIVDTWWQ
TETGMQMITTMVGEPMRPGFVGKGIPGVVADVVDKDGASVPLGSGGFLVIRTPWPAMFRT
IYNNDERYRQYWETIPGVYTAGDLAVKGTDGYIMVIGRSDDIIIISGHNIGTAEVESALV
SHQAVAEAAAIGKPDPLKGNSIKAFVILRVGNAPSEKLKKDLMYHVRMTIGPIAVPQEIA
FVEKLPKTRSGKIMRRVLKAQEMGVDPGDISTLEE
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagattaaggaatcattcgatgtgaaactcgcagaggatgaaaagtattatgtc
cctgacgaaaaataccgccgtacatcttggattggggactatcagcgcaggtacgacgag
ttccttgccgacccggatgcattctggaacgacattgcagaggaactcgactgggtcaga
cactgggatagggttctcgagtggaactacccttacgcgaaatggttcgtcaatgccagg
ctgaacatcacatccaactgcctagaccgccatgttgccagtgaccggcggaacaaggcc
gccctgatctggcgtggggaggatggaacagaacgggtctatacctaccagaaattgctg
acagaggtgatccactttgcgaatggcctcaagaaggtcggggtttcgaaaggggacagg
gtctgcatttacatgccgatggtccctgaacaggcgatcgccatgctggcctgtgcccga
atcggtgctgtacacagtgtggtcttcgccgggttcggtgagaccgcattgaatatgagg
atcacggacgcccaggccaagattgtgatcaccgccgacatctcgatacgacgcggaaag
gcgatcccgctgatcaccatcgtcaaggaggcgatcctgaacgctccgagtgtagaacac
ctggtgatcctccgccggcggagggaacccccggtggagatgcggcctgactttgaactc
gacttctatgaactgatgagaaacggaggtgctgattgcccccccgaggcgatggatgca
gaagatccgctctttatgctctatacgagtggttcaaccggtaccccaaagggggtggtc
catacctgcggaggctacatggtcgggacgtactacacgagcaagtatgtcttcgacctc
aaggagaacgacatctactggtgcacagcagaccccggctggatcaccggccacagttac
attgtgtacggaccgttgatcgtcggcgccaccgtcttcatcagtgagatgactctggat
tacccggaccccggcatctggtggaggctgatcgaggagcagcggatcaatatcttctac
acggcgccgactgcaatccggacattcatgaaactgggggaggcatggccggagaaatat
gacctcagttccctccggatcatcgggtcggtgggcgaaccgctcaaccccgaggccttt
gaatggtactaccatgtgattggaaaggaccgctgtccgatcgtcgacacctggtggcag
actgagaccggtatgcagatgatcaccacaatggtcggtgagccgatgcgccccggcttt
gtcggaaaggggatccctggcgtggtggctgatgtcgtggacaaagatggtgcgtcagtt
ccacttggttcaggtgggttcctggtcatccgaactccctggccggcgatgtttcggacc
atctacaacaatgacgaacggtaccggcagtactgggagacgattccaggggtctatacc
gccggcgacctcgcggtgaagggaacggacgggtatatcatggtgatcggccgatccgat
gacatcatcatcatatccgggcataacattgggaccgctgaggtggagagcgccctcgtc
tcccatcaggcggttgccgaggccgctgccattggaaaaccagatccattgaaagggaac
agcatcaaagcgttcgtcatcctccgggtggggaacgccccgagtgagaaactgaagaag
gacctgatgtaccacgtgcggatgaccatcggcccgatcgctgtgccgcaggagatcgcg
ttcgtcgagaaactgccaaagacgcgaagcgggaagattatgcgccgggttctgaaagct
caggagatgggcgtcgaccccggtgacatctccaccctagaggagtag

DBGET integrated database retrieval system