KEGG   Candidatus Methanosphaerula palustris: Mpal_0635Help
Entry
Mpal_0635         CDS       T00823                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpal_0635 (gpmA)
   01230 Biosynthesis of amino acids
    Mpal_0635 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpal_0635 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Mpal_0635 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpal_0635 (gpmA)
Enzymes [BR:mpl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mpal_0635 (gpmA)
Exosome [BR:mpl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mpal_0635 (gpmA)
  Exosomal proteins of melanoma cells
   Mpal_0635 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
632141..632890
Genome map
AA seq 249 aa AA seqDB search
MYTLVLLRHGESAWNKENRFTGWTDVDLSPQGIEEAHRAATLLHDGGYSFDLAYTSVLKR
AIRTLWIVLDDLDLMYLPVHHTWRLNERHYGALQGLDKRETTEKFGKDQVQAWRRGYAVR
PPALEETDPRHPRFDPRYAGLKKDDLPATESLEDTLARVVPYWNETIVPTLQDGKRILIA
AHGNSIRALVKYLDGVPDDVITGLNIPTGFPLVYELDDDLHPIRHYYLGDEEEIRRATES
VASQTATKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtacacactggtattgctgcgacacggagagagtgcatggaacaaagagaaccggttc
accgggtggacggacgtcgacctctccccccaggggatcgaagaggcccaccgggcggcc
acgctcctccacgacggcggctactccttcgacctcgcctacacctcggtcctgaaacgg
gcgatccggaccctctggatcgtcctcgacgacctggacctcatgtacctcccggtccat
cacacctggcggctgaacgaacgccactacggcgctctgcaggggctggacaagcgcgag
accaccgagaagttcgggaaggaccaggtccaggcctggcgccggggatatgcggtccgg
cccccggccctggaggagaccgacccccggcacccgcgcttcgacccccgctacgccggc
ctgaagaaagatgacctgccggccaccgaatcgctggaggacacactggcccgggtggtc
ccctactggaacgagacgatcgttccgacgctacaggacgggaaacggatcctgatcgcc
gcccacggcaacagcatccgtgccctcgtcaagtacctcgacggggttcccgacgacgtg
atcaccggcctcaacatcccgaccgggttccccctcgtctacgagctcgacgacgacctg
caccccatccgccactattacctgggcgatgaagaggagatccggcgtgcgacagagtcg
gtcgcgagccagaccgcgacgaagaaatga

DBGET integrated database retrieval system