KEGG   Candidatus Methanosphaerula palustris: Mpal_0797Help
Entry
Mpal_0797         CDS       T00823                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
mpl00010  Glycolysis / Gluconeogenesis
mpl00030  Pentose phosphate pathway
mpl00051  Fructose and mannose metabolism
mpl00680  Methane metabolism
mpl01100  Metabolic pathways
mpl01110  Biosynthesis of secondary metabolites
mpl01120  Microbial metabolism in diverse environments
mpl01130  Biosynthesis of antibiotics
mpl01200  Carbon metabolism
mpl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpal_0797
   00030 Pentose phosphate pathway
    Mpal_0797
   00051 Fructose and mannose metabolism
    Mpal_0797
  Energy metabolism
   00680 Methane metabolism
    Mpal_0797
Enzymes [BR:mpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mpal_0797
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mpal_0797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ACL16159
JGI: Mpal0797
UniProt: B8GG85
Position
complement(809821..810717)
Genome map
AA seq 298 aa AA seqDB search
MGGEEISTITVAVRAVGGYPGHARIHPKVLERAARVVKEQVKAGTVTDSGIIHCGDLLGL
ILTGAIPDDLIERTFTAGQNEATELHLCPSQGNSLTLELTLTEREHEPVLVLMTDTGRTV
AQILYRIFADPLMTTRLVSDPCLREGFVFELTLLDGVQHRYTTPGETYQLLGCLTDEEMK
GIRVLKQDGTIAAVAGIERTGGAIIIRTEGSFPSVDEVLAPFLSPHLMAGMTLMPVSICD
AHTTKATSPSRITAFGFALNRGRLIGPADLFDDPAFDPSRQAAVRMAGTRRMQGPFRP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggaggagaggaaatttccacaatcaccgtggctgtacgagcggtcggggggtacccg
gggcatgcccggatccatccgaaggtgctcgaacgggcagcacgagtagtaaaggagcag
gtgaaggccgggacggtcactgactcagggatcatccactgcggagacctgctcggactg
atcctgaccggtgcgataccagatgatctgatcgaacggacctttacggccggccagaac
gaggcgacggagttgcacctctgtccatcacagggtaattccctgaccctcgaactcacc
ctcaccgagcgggagcacgagccggtgctggtgttgatgacggacacgggaaggacggtc
gcccagatcctgtaccgtatcttcgctgacccactcatgacaacacggctggtcagcgac
ccgtgcttacgggaagggttcgtcttcgaactgaccttgctggacggggtacagcaccgt
tataccaccccaggagagacataccaactcctaggatgcctcacagacgaggagatgaag
ggtatcagggtactaaaacaggatggcaccatagcagcggtggccggcatagagaggaca
ggaggggcgatcatcatcagaactgagggatcgtttccgtcggtcgacgaggtgcttgca
cccttcctctccccccacctgatggcagggatgaccctgatgccggtcagcatctgtgac
gctcacaccacaaaagcaaccagcccttcgcggatcacggcgttcggattcgctctgaac
aggggtagactgatcggcccggcagacctcttcgatgacccggccttcgatccatccaga
caggctgcggtgcggatggccggaacccgccggatgcaggggccgtttcggccctga

DBGET integrated database retrieval system