KEGG   Candidatus Methanosphaerula palustris: Mpal_0797Help
Entry
Mpal_0797         CDS       T00823                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpal_0797
   01230 Biosynthesis of amino acids
    Mpal_0797
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpal_0797
   00030 Pentose phosphate pathway
    Mpal_0797
   00051 Fructose and mannose metabolism
    Mpal_0797
  Energy metabolism
   00680 Methane metabolism
    Mpal_0797
Enzymes [BR:mpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mpal_0797
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mpal_0797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(809821..810717)
Genome map
AA seq 298 aa AA seqDB search
MGGEEISTITVAVRAVGGYPGHARIHPKVLERAARVVKEQVKAGTVTDSGIIHCGDLLGL
ILTGAIPDDLIERTFTAGQNEATELHLCPSQGNSLTLELTLTEREHEPVLVLMTDTGRTV
AQILYRIFADPLMTTRLVSDPCLREGFVFELTLLDGVQHRYTTPGETYQLLGCLTDEEMK
GIRVLKQDGTIAAVAGIERTGGAIIIRTEGSFPSVDEVLAPFLSPHLMAGMTLMPVSICD
AHTTKATSPSRITAFGFALNRGRLIGPADLFDDPAFDPSRQAAVRMAGTRRMQGPFRP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggaggagaggaaatttccacaatcaccgtggctgtacgagcggtcggggggtacccg
gggcatgcccggatccatccgaaggtgctcgaacgggcagcacgagtagtaaaggagcag
gtgaaggccgggacggtcactgactcagggatcatccactgcggagacctgctcggactg
atcctgaccggtgcgataccagatgatctgatcgaacggacctttacggccggccagaac
gaggcgacggagttgcacctctgtccatcacagggtaattccctgaccctcgaactcacc
ctcaccgagcgggagcacgagccggtgctggtgttgatgacggacacgggaaggacggtc
gcccagatcctgtaccgtatcttcgctgacccactcatgacaacacggctggtcagcgac
ccgtgcttacgggaagggttcgtcttcgaactgaccttgctggacggggtacagcaccgt
tataccaccccaggagagacataccaactcctaggatgcctcacagacgaggagatgaag
ggtatcagggtactaaaacaggatggcaccatagcagcggtggccggcatagagaggaca
ggaggggcgatcatcatcagaactgagggatcgtttccgtcggtcgacgaggtgcttgca
cccttcctctccccccacctgatggcagggatgaccctgatgccggtcagcatctgtgac
gctcacaccacaaaagcaaccagcccttcgcggatcacggcgttcggattcgctctgaac
aggggtagactgatcggcccggcagacctcttcgatgacccggccttcgatccatccaga
caggctgcggtgcggatggccggaacccgccggatgcaggggccgtttcggccctga

DBGET integrated database retrieval system