KEGG   Candidatus Methanosphaerula palustris: Mpal_0952Help
Entry
Mpal_0952         CDS       T00823                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mpl  Candidatus Methanosphaerula palustris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
985863..987443
Genome map
AA seq 526 aa AA seqDB search
MDKTEIYREILSLISSESADPYQILQIKRAVCGRYELPEVPKNSALLAAAPPEEYEQFRR
LLLVKPTRTLSGVAPIAVMTSPSPCPHGKCLPCPGGPDHPFKSPQSYTGEEPAAKRAREH
NYDPYNQVLARLDQFRLLGHHVDKAELIVMGGTMTARTPEYQESFVAACLQAMNESGTGV
RRELQPLETVMQANERSDVRCVALTFETRPDWSRREHIDSMLRLGVTKVELGVQHLDDEI
LTFNRRGCTVADIVEANTSLRDAGIKVGFHMMPNLPGSTIEKDRAMFRTLFDDPRFRPDF
LKLYPTLVTPYSEIEDLLNRGGYAPYAEDDLIDLIAYAKELLPEYVRLQRVQRDIPAKLI
VAGSHHSNFRQLAEGRLHAAGKRCRCIRCREIGRYPPPKGAVAGIQTLAYDCCGGREFFI
SAVAGDSLIGFLRLRFPGNPWREELADAALVRELHVYGMVVPIGDEAEPAEYQHRQFGVQ
LLAEAERLAGDAGFSSLAIMSGIGVRPYYQRQGYMRTGPYMVKRLV
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggataaaactgaaatctatcgggagatcctctccctcatctcttctgaatctgcagat
ccgtaccaaatcctgcagatcaaacgtgcagtctgtggccgctatgaactcccggaggtg
ccgaagaactcagcgttgctcgccgcagcccctcctgaagagtatgaacagtttcggcgc
ctgctgctggtgaaaccgacccggaccctctccggggtcgcaccgatcgcggtgatgacc
tctccctctccctgtccgcatgggaagtgtctcccctgtccggggggtccggaccatccg
ttcaaatccccgcagagttacacgggtgaagagccggccgcaaagcgggcacgtgagcat
aactacgacccgtataaccaggtcttggcccggctcgatcagttcaggctgcttggccac
cacgtcgacaaggcagaactgatcgtgatgggcggtacgatgaccgcccggaccccagag
taccaggagtcgttcgtggcagcctgtctgcaggcgatgaacgagtccgggaccggggtt
cgaagagaactgcagccgctggagacggttatgcaggcgaacgaacgatcggatgtccgg
tgcgtcgccctgacctttgagacccggccggactggtccagacgggaacatatcgacagc
atgctccgcctcggtgtcaccaaggttgagcttggggttcagcacctggacgacgagatc
ctcaccttcaaccgtcgcggctgcaccgtcgccgacatcgtggaggcgaacacgtccctc
cgggacgccgggatcaaggtcgggtttcacatgatgccgaacctgcccggttcgacgatt
gagaaggaccgggcgatgttccggaccctcttcgacgatcctcgattccgaccggacttc
ctgaaactgtatcccacgctggtcacaccctattcagagatcgaagacctgctgaaccgg
ggagggtatgcgccgtatgcagaggacgatctgatcgacctgatcgcctacgccaaggaa
ctcctccctgagtacgtccgcctccagcgggtccagcgggacattcccgccaagctgatc
gttgccggctcccaccacagcaacttccggcagctggcagagggccggctgcacgccgcc
ggaaaacggtgccggtgcatccgttgtcgcgagataggccgctacccgccgcccaaaggt
gcagtggctgggatccagaccctggcctacgactgttgcggagggcgggagttcttcata
tcggcggtggctggcgactcgctgattgggttcctccggctgcggtttccggggaatccc
tggcgtgaggaactggcagatgcagctctggttcgcgagctgcatgtctatggaatggtc
gtcccgatcggcgatgaggctgagcctgccgagtaccagcaccgacagttcggggtgcaa
ctgctcgccgaggcggaacgcctggccggcgacgccggtttctcttcgctcgctatcatg
agcgggatcggggtgcgcccctactaccagagacagggatatatgcgaaccggcccctat
atggtaaaacgacttgtatga

DBGET integrated database retrieval system