KEGG   Candidatus Methanosphaerula palustris: Mpal_1027Help
Entry
Mpal_1027         CDS       T00823                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mpal_1027
Enzymes [BR:mpl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mpal_1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1053721..1054266
Genome map
AA seq 181 aa AA seqDB search
MLDQEFERIGKRLFSEGLVGGNFGNMSVKDGGSFHITQTGSYLDEPGSPIKVPIIGQVPP
KASSEYRVHRAIYLETQHTAIVHAHPAHAVALSLLIDEIVPEDSEGQMLCPTIRVVSAPP
GSKELAHEVGSALQLRNVVIARGHGTFAAASSLNEAYLFTSLAEHACRVLFLKEQYLRDR
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgctggatcaggaatttgaacggataggaaagcggctcttctctgaagggctggtcggt
gggaactttggaaacatgtcggtcaaggacggtgggtcgttccatatcacccagaccggc
agttatctcgatgaaccagggtctccgatcaaggtgccgatcatcgggcaggtgccgccg
aaggcatcgagcgagtacagggttcatcgcgcgatctatctggagacccagcataccgcc
atcgttcatgcccatccagcccatgcggtcgcactctcgttgttgatcgacgagatcgtc
ccggaggacagtgaggggcagatgctctgcccgacgatccgcgtggtcagcgcaccaccg
gggtccaaggaactggctcatgaggtcgggtctgcgctgcagcttcgaaacgtggtgatc
gccagggggcacgggacgttcgctgcggcctcgtctctgaatgaggcatacctcttcact
tcgctcgccgagcatgcctgcagggtgctattcctcaaggaacagtacctcagggatcgg
gggtga

DBGET integrated database retrieval system