KEGG   Candidatus Methanosphaerula palustris: Mpal_1319Help
Entry
Mpal_1319         CDS       T00823                                 

Definition
(RefSeq) acetate/CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpal_1319
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpal_1319
   00620 Pyruvate metabolism
    Mpal_1319
   00640 Propanoate metabolism
    Mpal_1319
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpal_1319
   00680 Methane metabolism
    Mpal_1319
Enzymes [BR:mpl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mpal_1319
Lipid biosynthesis proteins [BR:mpl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mpal_1319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1354405..1356300
Genome map
AA seq 631 aa AA seqDB search
MPEDFDVKLDNKYHLPDPAFIQNSSIMDYEKVYQESLSDPEGFWEKIAEDLHWYRRWDKV
LEWEHPYARWFVNGKTNITYNCLDRHVFGGRRNKVALIWKGEGDDDERIFTYRHLYHAVN
RFANGLRKLGVLKGDRVCIYMPMVPEQIIAMLGCARIGAVHTVVFGGFGSAALNARIVGA
EAKIVVTADYAVRRGKSIPLKHLIEEAIINAPSVEHVIVLRRKQDQPIEIHSEMEIDYDE
LMASVDRKCEIEVMDAEDPLFILYTSGTTGAPKGIVHTCGGYMVGTYYTTKHVFDVKEND
VYWCTADPGWITGHSYVVYGPLMQGTTVVIAECTPDYPDPGSWWSIMEEYGVNILYTAPT
AIRMFMKMGELWPDRYDLSYLRVLGSVGEPLNPEAFEWFYKTIGKEKCPIVDTWWQTETG
MHMLTTMVGQPMRPGFTGKSIPGVVVDVVDKDGESVPPGTGGFLVVKKPWPAMMRTVVNN
DPIYRKYWSTIKDYYTAGDLAVKGDDGYIMVIGRSDDLIIVSGHNIGTAEVESALVSHKA
VAEAAVIGKPDPMKGNIIKAFVTLRVGHQPTDRLRNELIYHVRITLGPIAMPSEIEFVDS
LPKTRSGKIMRRVLKAQEMGLDPGDTSTLDE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagactttgatgtgaaactggacaacaagtaccacctgcctgatccggcgttt
atccagaactcgtcgataatggactacgagaaggtctatcaggagtcactctctgacccg
gagggcttctgggagaagattgcagaggatctccactggtatcggcgctgggacaaggtg
ctcgagtgggaacacccctatgcccgctggttcgtcaacggcaagaccaatatcacctac
aactgcctggaccgtcatgtgttcggtggcaggaggaacaaggtcgccctgatctggaaa
ggggagggggatgacgatgaacggatcttcacgtaccgccacctgtaccatgcggtgaac
cggttcgccaatggacttcggaaactcggggttttgaagggcgatcgtgtctgcatctac
atgccgatggttccagaacagatcatcgcgatgctcggatgcgcacggatcggtgcggtc
cataccgtggtcttcggtgggttcggatcggccgccctgaatgcgaggatcgtcggggca
gaagccaagatcgttgtcactgcagattatgctgtcaggcgtgggaagtcgatcccgctc
aagcacctgatcgaggaggcgatcatcaatgctccgtcggtcgagcatgtgatcgtcctt
cggcggaagcaggaccagccgatagagatccattctgagatggagatcgattatgatgaa
ctgatggccagtgtggatcgaaagtgtgagatcgaagtgatggatgctgaagacccgctc
tttatcctgtacacctcaggcaccaccggggcaccgaaagggatcgtgcacacctgtggg
gggtacatggttggcacctactacacgaccaaacatgtctttgatgtcaaggagaacgac
gtctactggtgcacggccgatcccggctggatcaccggccactcgtacgtggtctacgga
cccctgatgcaggggaccaccgtcgtgattgcagagtgtacgcctgactatcccgacccg
ggttcctggtggtcgatcatggaggagtacggggttaacatcctctatacagccccgact
gccatccggatgttcatgaagatgggcgaactgtggcccgataggtatgatctctcgtac
ctccgggtgctcggatcggtcggggaacccctgaatcctgaggcgttcgagtggttctat
aaaacgatcggaaaggagaagtgtccgatcgtcgacacctggtggcagaccgagaccggg
atgcacatgctgaccacgatggtcggtcaaccgatgcgacccgggtttaccgggaagtcc
attcccggcgtggttgtggatgtggtcgataaggacggcgaatcggtcccccccggaacc
ggcgggttcctggtcgtgaagaaaccctggccggcgatgatgcggacggtggtgaacaac
gacccgatctacaggaagtactggtccaccatcaaggattactacaccgccggggacctg
gccgtgaagggcgatgacgggtatatcatggtgatcggtcggtcggatgacctgatcatc
gtatcaggtcacaacatcgggacagccgaggtggagagcgccctggtctcccataaagca
gtggctgaggctgcagtgatcggtaaaccagacccgatgaaggggaatatcatcaaagcc
ttcgttacgcttcgggtcggtcaccagccgaccgatcggctcaggaacgaactgatctac
catgttcggatcacgctcggcccgattgcgatgccttcagagatcgagttcgtcgactcg
ctgcctaagacgcgatcaggaaagatcatgcgcagggtcttaaaggctcaggagatggga
ctcgatcccggggatacctcaaccctggacgagtaa

DBGET integrated database retrieval system