KEGG   Candidatus Methanosphaerula palustris: Mpal_1560Help
Entry
Mpal_1560         CDS       T00823                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpal_1560
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpal_1560
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mpal_1560
Enzymes [BR:mpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mpal_1560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1608695..1609900
Genome map
AA seq 401 aa AA seqDB search
MYRLVCVHCGAVYAPDQILYNCRSCGHLLAVQYDLDTISVDRKTWNQRPLSVWRYRELLP
VTGEPVTLQEGGTPLYHLKKLGAEMGLPHLYAKHEGMNPSGSFKDRGMTVGVSMAIQLGM
KSVACASTGNTSASLAVYGARAGIPAVVLLPAGKVAIGKVAQALMHGAKVISIRGNFDRA
LEMVHELCLSEGIYLLNSINPYRLEGQKTIGYEVIDQLGEVPDRFVLPVGNAGNISAVYK
GLRELESLGFIDHLPKMTGIQAAGSAPVVRAIREGLAVVEAEMSPETVATAIRIGAPVNA
EKALVAIRETGGTAEAVTDEEILCMQRDLARKEGIGVEPASAASVAGIRKLAEQGMLDRD
ETIVCVVTGHLLKDPESVIRQCEPPIEIDADMQSLLAALQR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtctcgtgtgtgttcattgtggtgcagtctatgccccggaccagatcctgtac
aactgcagaagctgtggacacctgcttgccgtccagtacgatctggacaccatctctgtt
gaccgcaaaacctggaaccagcggccgctctctgtctggcggtaccgtgaactgctgccg
gtgaccggcgagccggtgacgctgcaggaggggggtacgccgctctatcacctcaagaaa
ctcggggcagagatggggctcccccacctctacgccaaacacgagggaatgaacccgtcc
ggatcgttcaaggaccgggggatgaccgtcggggtctcgatggccatccagcttgggatg
aagagtgtggcctgcgccagcacaggaaacacctcggcgagtctggccgtctacggggcc
cgggccgggatcccggcggtggttctgctgccggccggcaaggtcgcgatcggcaaggtc
gcccaggccctgatgcacggggcgaaagtgatctcgatacggggcaactttgatcgggct
ctggagatggtccacgaactctgcctgagtgaggggatctacctgctgaactcgatcaac
ccgtaccggcttgaagggcagaagacgatcggatacgaagtgatcgaccagctcggtgag
gtgccggatcggttcgtccttcctgtcggaaacgccgggaatatatcagcggtctataag
gggcttcgagaactcgaatcgctcgggttcatcgatcacctcccaaagatgaccgggatc
caggccgcaggatcggccccggtggtcagggcgattcgagaagggctcgccgtcgtcgaa
gctgagatgtctcctgagacggtcgccacggcgatcagaatcggggccccggtgaatgct
gagaaggcgctggtcgcaatccgggagaccggcggcacggccgaggcggtgactgacgag
gagattctctgcatgcagcgtgatctggccaggaaggaagggatcggtgtggagccggcc
tcagccgcctcggtcgcagggatacggaagctggctgagcaggggatgctggatagggac
gaaacaatcgtctgcgtggtgaccggacacctcctcaaagatccggaatcggtgatacga
caatgcgaacccccgatcgagatcgacgcggacatgcagtccctgctcgctgccttgcag
cgctga

DBGET integrated database retrieval system