KEGG   Candidatus Methanosphaerula palustris: Mpal_1560Help
Entry
Mpal_1560         CDS       T00823                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpal_1560
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpal_1560
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mpal_1560
Enzymes [BR:mpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mpal_1560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1608695..1609900
Genome map
AA seq 401 aa AA seqDB search
MYRLVCVHCGAVYAPDQILYNCRSCGHLLAVQYDLDTISVDRKTWNQRPLSVWRYRELLP
VTGEPVTLQEGGTPLYHLKKLGAEMGLPHLYAKHEGMNPSGSFKDRGMTVGVSMAIQLGM
KSVACASTGNTSASLAVYGARAGIPAVVLLPAGKVAIGKVAQALMHGAKVISIRGNFDRA
LEMVHELCLSEGIYLLNSINPYRLEGQKTIGYEVIDQLGEVPDRFVLPVGNAGNISAVYK
GLRELESLGFIDHLPKMTGIQAAGSAPVVRAIREGLAVVEAEMSPETVATAIRIGAPVNA
EKALVAIRETGGTAEAVTDEEILCMQRDLARKEGIGVEPASAASVAGIRKLAEQGMLDRD
ETIVCVVTGHLLKDPESVIRQCEPPIEIDADMQSLLAALQR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtctcgtgtgtgttcattgtggtgcagtctatgccccggaccagatcctgtac
aactgcagaagctgtggacacctgcttgccgtccagtacgatctggacaccatctctgtt
gaccgcaaaacctggaaccagcggccgctctctgtctggcggtaccgtgaactgctgccg
gtgaccggcgagccggtgacgctgcaggaggggggtacgccgctctatcacctcaagaaa
ctcggggcagagatggggctcccccacctctacgccaaacacgagggaatgaacccgtcc
ggatcgttcaaggaccgggggatgaccgtcggggtctcgatggccatccagcttgggatg
aagagtgtggcctgcgccagcacaggaaacacctcggcgagtctggccgtctacggggcc
cgggccgggatcccggcggtggttctgctgccggccggcaaggtcgcgatcggcaaggtc
gcccaggccctgatgcacggggcgaaagtgatctcgatacggggcaactttgatcgggct
ctggagatggtccacgaactctgcctgagtgaggggatctacctgctgaactcgatcaac
ccgtaccggcttgaagggcagaagacgatcggatacgaagtgatcgaccagctcggtgag
gtgccggatcggttcgtccttcctgtcggaaacgccgggaatatatcagcggtctataag
gggcttcgagaactcgaatcgctcgggttcatcgatcacctcccaaagatgaccgggatc
caggccgcaggatcggccccggtggtcagggcgattcgagaagggctcgccgtcgtcgaa
gctgagatgtctcctgagacggtcgccacggcgatcagaatcggggccccggtgaatgct
gagaaggcgctggtcgcaatccgggagaccggcggcacggccgaggcggtgactgacgag
gagattctctgcatgcagcgtgatctggccaggaaggaagggatcggtgtggagccggcc
tcagccgcctcggtcgcagggatacggaagctggctgagcaggggatgctggatagggac
gaaacaatcgtctgcgtggtgaccggacacctcctcaaagatccggaatcggtgatacga
caatgcgaacccccgatcgagatcgacgcggacatgcagtccctgctcgctgccttgcag
cgctga

DBGET integrated database retrieval system