KEGG   Candidatus Methanosphaerula palustris: Mpal_1715Help
Entry
Mpal_1715         CDS       T00823                                 

Definition
1-phosphofructokinase (EC:2.7.1.144)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpal_1715
   01230 Biosynthesis of amino acids
    Mpal_1715
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpal_1715
   00030 Pentose phosphate pathway
    Mpal_1715
   00051 Fructose and mannose metabolism
    Mpal_1715
   00052 Galactose metabolism
    Mpal_1715
  Energy metabolism
   00680 Methane metabolism
    Mpal_1715
Enzymes [BR:mpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mpal_1715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1787552..1788526
Genome map
AA seq 324 aa AA seqDB search
MIYTVTLNPALDRTIEVDQIRCDVANRIIEEHWYPGGKGVDVSRVLTTLGADTLAFGFIG
GFRGDQLEAGLITAGIGCDFIRIAGETRSNLVIHEQLIDTQVLLNSRGPEVEPSAMMALL
RKIRNLQNPGLLTIGGSLPPNLNPSIYRTIIEIAQERGGTVLFDADGAALKAGIEGKPYA
IKPNLHELSELVDRPLNSLEEILSAAQEPLEAGVKVVLASLGPDGILLVSKDLILHGIPP
KVKVKNTIGAGDSAVAGFVYALAEGKDVQEALIYAVAAGTATTMRSGTALGKREDIMALI
PQVQVKNIPLPDRSPGQNNPAKRT
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgatctatactgtgacactgaatccggctcttgaccggacgatcgaggtcgaccagatc
cgctgtgatgtcgcaaaccggatcattgaggagcattggtaccccggtggaaagggggtc
gacgtatcgagggtgttgaccaccctcggtgctgatacactggcctttggatttatcgga
ggttttcggggagaccagctcgaagccggcctgatcaccgcagggatcggctgcgacttt
atccggattgccggtgaaaccaggtcgaacctagtgatccatgaacaattgatcgataca
caggtgctcctcaactccagggggccggaggtcgaacccagtgcaatgatggcactgctt
cgtaagatccggaatctgcagaacccgggactgctgactatcggcgggagtcttccccca
aatctgaatccttcaatctacaggacgatcattgagatcgcacaggaacgtggtggtacg
gtcctcttcgatgcagatggagctgccctgaaggcggggatcgaggggaagccctatgcg
atcaaaccgaacctccatgaactttcagaactggtcgacagaccgctgaactctctggaa
gagatcctctctgcagcacaggaaccacttgaagcgggcgtgaaggtggtactcgcctca
ctcggcccggatggaattctactggtctcaaaggatctgatcctccatgggataccacca
aaggtcaaggtaaagaacaccatcggagcgggggactcggcagtcgccgggtttgtctat
gccctcgccgaagggaaggatgttcaggaagcactgatctatgctgtggcagcaggaacc
gcgaccacgatgcggtcaggtacggcattaggaaaaagagaggatatcatggcactgata
ccacaagtgcaggtgaagaacatccccctgccggacagaagtccaggtcagaacaatcct
gcaaagaggacatag

DBGET integrated database retrieval system