KEGG   Candidatus Methanosphaerula palustris: Mpal_1731Help
Entry
Mpal_1731         CDS       T00823                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpal_1731
   01230 Biosynthesis of amino acids
    Mpal_1731
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpal_1731
   00051 Fructose and mannose metabolism
    Mpal_1731
   00562 Inositol phosphate metabolism
    Mpal_1731
Enzymes [BR:mpl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mpal_1731
Exosome [BR:mpl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mpal_1731
  Exosomal proteins of bladder cancer cells
   Mpal_1731
  Exosomal proteins of melanoma cells
   Mpal_1731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1801099..1801767)
Genome map
AA seq 222 aa AA seqDB search
MSSQFILVNLKAYKEGMGPRAHMIARAAEEVSEESGIQIGVAPSFFDLHPLSKHFEIPVF
AQHLDGVVPGAFTGHVTAAAVRQTGAVGTLINHSERRLTLAEIEASVRAATEAGLVTVIC
SNNDMTSAAAAALSPTYVAIEPPELIGSGVSVAKADPGIIQRSVAAVHAVNPKVKVLTGA
GIQSGECVKIARDLGTDGVLLASSVVKVEDPAIVLRDLVSLL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcacagttcattctggtaaacctcaaggcctacaaggaagggatgggcccccga
gcccatatgattgcgcgagctgcagaagaggtcagtgaggagagcggcattcagatcggg
gtcgcaccctcgttcttcgacctccatcctctgagcaaacactttgagatcccggtcttt
gcacagcatctggacggcgttgtccctggtgcgtttaccggtcatgtgaccgccgccgcg
gtcagacagaccggtgcggtggggactctgatcaaccactctgaacggaggctgactctt
gctgagatcgaagccagtgtgcgggctgcgacggaagcagggctggtcacggtgatctgt
tcaaacaacgatatgaccagtgcagcggcagcggccctttcaccgacctatgttgcgatt
gaaccgccagaactgatcggtagcggggtgtcggtggccaaggcggaccccgggatcata
caacgatcagtggcagccgtgcacgcggtgaatccaaaggtgaaggtgttgaccggtgcc
ggcatccagtcgggggaatgtgtgaagatcgcccgtgacctcggaacagatggtgtactg
ctcgcctcaagcgtggtcaaagttgaagaccctgccatcgtgctcagagatctggtctcc
cttctctag

DBGET integrated database retrieval system