KEGG   Candidatus Methanosphaerula palustris: Mpal_1834Help
Entry
Mpal_1834         CDS       T00823                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mpl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mpl00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mpl00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mpl00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mpl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1948049..1949707
Genome map
AA seq 552 aa AA seqDB search
MEPVEHMEYQEACEKFRITVPENFNFGFDVIDAWATKDRNQLAMIWTNEHGDEKKFTYRD
LKNLSNQAANILLKYGIKKGDRVILLLPRVPEWWIFAIALIKLGAVFCPCPTLLTPKDLK
YRINAGKFKMIITNLENASKIEEISDQCPPLSTRFLVDGEKKGWASFQYELLYPAPVSHR
TVSLPITRKTRASDPMLIYFTSGTTGEPKMALHNQAYALGHEVTAALWQDIRPTDLHCTL
SDTGWAKNAWGNIFGQWIQGACLLIFDIRGKFNATEILPLLEKYEVTTFCAPPTIYRMLI
LADLDKFDLKDLRRCVSAGEPLNPEVIRVWKEGTGLPICEGYGQSETVCCIGNFPGISPR
PGSMGKPAPGWKIELHDDEGQPVPIHEEGRIAINLDPWPVGLIIEYLENPEANKDSFKNG
WYYTGDKAYMDEDGYYWFIGRDDDVIKSAGYRIGPFEVESALLEHPSVQECAVVGSPDMI
RGLIVKAFVILNQGFEPSEALVKDLQNHVKRTTAPYKYPRAIEFVSELPKTISGKIRRNE
LRRLEQERSDSS
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagttgaacatatggagtaccaggaagcctgtgagaaattcaggatcaccgtc
cctgaaaattttaatttcggttttgacgtgatcgatgcctgggcaacaaaggatcggaat
cagcttgcgatgatctggacgaacgaacacggtgacgagaagaagttcacctacagagat
cttaaaaatctctccaaccaggccgcaaacattctcctgaagtatggaatcaagaaaggt
gatcgcgtgatcctcctcctcccacgggtcccggagtggtggatctttgccatcgccctg
atcaagctcggtgcggtattctgcccctgccccacgcttctcaccccaaaagacctcaag
tacaggatcaatgccggcaagttcaagatgatcatcacgaacctggagaacgcatctaag
atcgaggagatctcagatcagtgtccgccgctctcgacccggttcctggtcgacggtgaa
aagaaagggtgggcgtcgttccagtatgaactgctctatcccgccccggtttcgcacaga
acggtctccctcccgatcacaaggaagacccgggccagcgatccgatgctgatctacttc
acctcaggcaccaccggcgagcccaagatggcccttcataaccaggcatatgctctcggt
cacgaggtcaccgcagccctctggcaggacatcagacccaccgatctccactgcacactc
tctgataccggctgggcaaagaatgcatggggaaatatcttcggacagtggatccaggga
gcatgcctgctgatcttcgatatcagaggaaaattcaatgcaactgagattctgccgctt
ctggaaaagtatgaagtgaccaccttctgtgcacccccaacaatctatagaatgctcatc
ctcgcagacctcgataagtttgatctcaaggatctcagaagatgtgtatccgcaggtgaa
ccactcaaccccgaggtgatcagggtttggaaagaggggaccggccttcccatctgcgaa
ggatacgggcagagcgaaaccgtctgctgtatcggaaacttcccgggcatttcaccacga
cccggttcaatgggaaaaccggcaccaggatggaagatcgaactccacgacgacgaagga
cagccggtgccgatccatgaagagggacggatcgccattaaccttgacccatggccagtc
ggtctgatcatcgagtaccttgaaaatccggaggccaataaagactcgttcaaaaatggc
tggtattatactggagacaaggcatacatggatgaggatgggtattactggttcatcgga
agggatgacgacgtcatcaagagtgccggttaccggattggacccttcgaggtcgagagt
gccctgctcgagcacccatcagtccaggagtgtgcggttgtgggttcgcccgacatgatc
agagggttgatcgtcaaggcattcgtcatcttgaaccagggattcgaaccatctgaggca
ctggtcaaggatctccagaaccacgtgaaacggaccactgcaccgtataaatatccacgt
gccatcgagtttgtcagtgaactgcccaagaccatatcaggaaagatccgcagaaatgaa
ctgcgaagactggaacaggaacgatcggatagcagttaa

DBGET integrated database retrieval system