KEGG   Candidatus Methanosphaerula palustris: Mpal_1835Help
Entry
Mpal_1835         CDS       T00823                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpal_1835
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpal_1835
   00620 Pyruvate metabolism
    Mpal_1835
   00640 Propanoate metabolism
    Mpal_1835
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpal_1835
   00680 Methane metabolism
    Mpal_1835
Enzymes [BR:mpl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mpal_1835
Lipid biosynthesis proteins [BR:mpl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mpal_1835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1949717..1951432
Genome map
AA seq 571 aa AA seqDB search
MTGDLMRTQRTYSEAGGENSAFVPNMTDYDEARANFRIDVPEYFNFGFDVIDAWAKEDRN
RLAMIWVDQKGNEKTFTFRQFMNLSNQVANMLLKYGINKGDRVLIMLPRVPEWWIFSIAL
IKIGAVFCPCPTMLTQKDLKYRINAAKFRMVITNQENAEKIDEIWDACPSLTSRFLTDGE
RPEWINYKSELTYPAPASHRLVNLPGMKKTRSTDPMVIYFTSGTTGEPKMALHNQAYPLG
HLVTGGLWLDIHPNDLHLTLADTGWAKSAWGKFFGPWMKGAATLIYDFRSKFNSTEILPI
LSKYEVTTFCAPPTIYRMLILADLETFDLSQLRHCVSAGEPLNPEVIRAWKEGTGQTIYE
GYGQTELVLCIGTFPCMKAKPGSMGKPSPGWDVALLDEEGNPVPTGLEGKIAIRVSERHP
VGMFMGYLEGEHLNEDVFADGWYYTGDKAYQDEDGYFWFVGRNDDVIKSSGYRIGPFEVE
SALLEHPAVQESAVVGSPDVIRGMVVKAFVVLNPGFAPSESLVKEIQKYVKRTTAPYKYP
RIIEFVDSLPKTLSGKIRRNELRALELKKSE
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtgatcttatgagaacacagagaacatacagcgaggcagggggggagaattcc
gcctttgtcccgaatatgaccgactacgatgaagcacgagccaacttccggatcgatgtc
cccgagtatttcaacttcgggttcgatgtgatcgatgcctgggcaaaggaagatcgaaac
agactggccatgatctgggtggaccagaaggggaacgagaagaccttcacgttccggcag
tttatgaacctctccaatcaggtcgccaatatgctcctcaagtacgggatcaacaagggc
gaccgggtgctgatcatgctcccccgtgtacccgaatggtggatcttttcgatcgccctg
atcaagattggagccgtcttctgcccgtgcccgacgatgctgacacagaaggatctcaaa
taccggatcaatgcggcaaagttccggatggtgatcacaaaccaggagaacgccgaaaag
atcgatgagatctgggatgcctgcccgtcgctcacctcccggttcctgaccgacggagaa
cggccggaatggatcaattataagagcgaactcacgtatcctgcgccggcatcgcaccgg
ctcgtgaatctgccggggatgaagaagacccggtccaccgatccgatggtgatctacttc
acctcagggaccaccggcgaaccgaagatggccctccacaaccaggcttacccactcggt
cacctggtgaccggcggcctctggctcgacatccatcccaacgatctccacctgaccctg
gcggataccggctgggccaagtcggcatgggggaagttctttggaccatggatgaaaggg
gcggccacgctcatctatgatttcaggtccaagttcaactccaccgagatcctcccgatc
ctctccaagtatgaggtgaccaccttctgtgcgcccccgacgatctatcggatgctgatc
ctcgccgacctcgagaccttcgatctctctcagcttcgtcactgtgtctctgccggcgag
cccctgaatccagaagtgatcagggcgtggaaggaaggaacaggacagacgatctatgaa
ggctacggacagaccgaactggtcctctgcatcggaaccttcccctgcatgaaggcaaag
cccgggtccatggggaaaccctctcctggatgggacgtggccctcctcgatgaagaggga
aatccggtcccgacaggcctggaagggaagatcgccatcagggtgagtgaacggcacccg
gtcgggatgttcatgggctacctggaaggagaacatctgaacgaggatgtcttcgcagac
ggctggtattataccggggacaaggcatatcaggacgaggacggttacttctggtttgtc
ggcaggaatgacgatgtgatcaagagttccggctaccggatcggtcccttcgaggtcgag
agcgcactgctcgaacacccggctgtgcaggagtctgccgtggtgggatccccggatgtg
atcaggggtatggtcgtgaaggcattcgtcgtcctgaatccagggtttgccccgtcagag
tccctggtcaaggagatccagaagtacgtgaagcggaccaccgcaccgtacaagtatcca
cggatcatcgagttcgtcgattcgctcccaaagacgctctcaggcaagatccgacggaac
gaactccgggctcttgaactgaagaagagtgaataa

DBGET integrated database retrieval system