KEGG   Candidatus Methanosphaerula palustris: Mpal_1946Help
Entry
Mpal_1946         CDS       T00823                                 

Definition
succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpal_1946
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mpal_1946
   00640 Propanoate metabolism
    Mpal_1946
   00660 C5-Branched dibasic acid metabolism
    Mpal_1946
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpal_1946
Enzymes [BR:mpl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mpal_1946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2062115..2063197)
Genome map
AA seq 360 aa AA seqDB search
MKLREYEAKRIFGAAGIQVPRGVVITSPEEITSVAMPADKVVLKAQVDVGGRGKAGGILL
CPAAEATATATDLFGRTIKGLPVDQVLVEEQLPITHEYFLSIAIDRSTKQPILLFADAGG
VDIEATAAASSDAIRRVNVPRLMTDLPAFVIRDLLGDAPKELGTVINTLWHVFNNKDALL
AEINPLVTTTRGVYAADAKLIIDDNALWRQGITQNRDLTPREREAEQHGFSYVELDGSIG
VVGNGAGLTMATLDLIEYYEGKAANFLDVGGGADQERVRFAVQLLAGAPQVQVIIVNLLG
GITRCDEVARGIISAGVSQRVIVRMAGTNEAEGKALLAAHGYQMYESMDEAVAAAVEATR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcgtgaatacgaagcaaagaggatatttggtgcggcagggatccaggtcccg
cgtggggttgtgatcacgtcccctgaagagataacgagtgttgcgatgcccgccgacaag
gtggtgttgaaggcgcaggtggatgtcggcggccgtggaaaggccggcgggatattgctc
tgtccggcagcagaagcaactgcaacggcgaccgacctctttggacggacgatcaaagga
ttgccggtggaccaggtgctggtcgaggagcagctcccgatcacccatgaatacttcctc
tcgatcgccatcgaccggtcgacaaaacagccgatccttctctttgccgatgccggcggg
gttgatatcgaggcgaccgcagcggcctcctcagatgcgatccggcgggtcaatgtaccc
cggttgatgaccgatctgccggcgttcgtgatccgcgacctgctcggtgatgctccgaag
gaactgggcacggtcatcaacaccctctggcatgtcttcaacaacaaggacgccctgctc
gcagagatcaatcccctggtcacgaccacacggggggtctatgcggccgatgccaaactg
atcatcgacgacaacgccctctggcggcaggggatcacccagaaccgcgacctgacgccc
cgggagcgtgaagcagagcagcatggtttctcctatgtcgagctcgacggctccatcggg
gtggtcgggaacggcgccgggctgacgatggctacgctggatttgatcgagtattatgag
gggaaggccgcgaacttcctcgatgtcggcgggggtgcagaccaggaacgggtccggttt
gcggtccagctcctcgccggcgcaccccaggtgcaggtgatcatcgtgaacctgctcggg
ggaatcacccggtgtgatgaggtggccagggggatcatcagtgctggggtctcccagcgg
gtgatcgtcagaatggcggggaccaacgaagctgaggggaaggcattgcttgcagcacat
ggataccagatgtatgaaagtatggacgaagcggtcgccgccgccgtggaggcgacacga
tga

DBGET integrated database retrieval system