KEGG   Candidatus Methanosphaerula palustris: Mpal_2318Help
Entry
Mpal_2318         CDS       T00823                                 

Definition
carbamoyl-phosphate synthase small subunit
Orthology
K01956  
carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mpl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mpl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2464403..2465458
Genome map
AA seq 351 aa AA seqDB search
MKAVLGLEDGTYVVGEGFGAEGTCAGELVFSTQMTGYMEALTDASYAGQILMFTFPQIGN
YGVDEKNFQSPAVQTLGCVTQEICDKPATGQSLKRYYEEHGLFGIEGVDTRALTIITRQH
GTLRAALIVGSGDHEHAIALARAVPPISNQALIPRVSCKEAYRVPGPGRKIAVIDLGIKR
HMVISLNKRGADLGIFPYNTTAEEIEAFEPDALLISNGPGDPMQARDAIKTVSYLIGTMP
VFGICMGNQVTALALGAETHKLKFGHRGTNQPVRYLDGRIFITTQNHGFVVDQESLPEGC
TCSYTNLNDGTLEGFESSDLEISCVQFHPEAHGGPRDTESHFFDMIMRRIA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggttctggggcttgaagacgggacatatgtggtaggagaaggcttcggagca
gagggcacctgcgccggcgaactggttttctccacccagatgaccgggtatatggaggcg
ctgacggatgccagttatgccggccagatcctgatgttcacgttcccacagatcgggaac
tacggggtcgatgagaagaacttccagagtccggcagtgcagacgctcggctgtgtaacg
caggagatctgcgacaagccggcaacaggacagtctctgaagcgatactacgaagagcac
ggtcttttcgggattgaaggagttgacaccagggcgctgacgattataaccagacagcac
ggaacactcagggctgcactgatcgtcggaagtggagaccatgaacatgcgatcgctctg
gcacgggccgtacctccaatctcaaaccaggctctgatcccacgggtctcctgcaaagag
gcatacagggttcctggtccaggaaggaagattgcggtgatcgatctcgggatcaaacgg
catatggtcatcagcctgaataaacggggtgctgatctcgggatattcccatacaacaca
actgctgaggagatcgaggcctttgaacccgatgcactgctcatctccaacggaccaggg
gatccaatgcaggccagggatgcgatcaagaccgtctcatacctgatcgggaccatgcca
gtctttgggatctgcatgggaaatcaggtgaccgcgctggcgctgggagctgagacccat
aaactgaagttcggtcatcgtggcaccaatcagccggtaaggtacctggatgggaggatt
tttatcaccacccagaaccacggcttcgtcgtagaccaggagtccctccctgaggggtgt
acctgtagttataccaatttaaacgacggaaccctagaagggtttgaatcctcagaccta
gaaatctcctgcgttcaattccatcccgaggcccatggcggtccccgggatacagagagt
cacttttttgatatgattatgcggaggatagcctga

DBGET integrated database retrieval system