KEGG   Candidatus Methanosphaerula palustris: Mpal_2318Help
Entry
Mpal_2318         CDS       T00823                                 

Definition
carbamoyl-phosphate synthase small subunit
Orthology
K01956  
carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mpal_2318
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mpal_2318
Enzymes [BR:mpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     Mpal_2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2464403..2465458
Genome map
AA seq 351 aa AA seqDB search
MKAVLGLEDGTYVVGEGFGAEGTCAGELVFSTQMTGYMEALTDASYAGQILMFTFPQIGN
YGVDEKNFQSPAVQTLGCVTQEICDKPATGQSLKRYYEEHGLFGIEGVDTRALTIITRQH
GTLRAALIVGSGDHEHAIALARAVPPISNQALIPRVSCKEAYRVPGPGRKIAVIDLGIKR
HMVISLNKRGADLGIFPYNTTAEEIEAFEPDALLISNGPGDPMQARDAIKTVSYLIGTMP
VFGICMGNQVTALALGAETHKLKFGHRGTNQPVRYLDGRIFITTQNHGFVVDQESLPEGC
TCSYTNLNDGTLEGFESSDLEISCVQFHPEAHGGPRDTESHFFDMIMRRIA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggttctggggcttgaagacgggacatatgtggtaggagaaggcttcggagca
gagggcacctgcgccggcgaactggttttctccacccagatgaccgggtatatggaggcg
ctgacggatgccagttatgccggccagatcctgatgttcacgttcccacagatcgggaac
tacggggtcgatgagaagaacttccagagtccggcagtgcagacgctcggctgtgtaacg
caggagatctgcgacaagccggcaacaggacagtctctgaagcgatactacgaagagcac
ggtcttttcgggattgaaggagttgacaccagggcgctgacgattataaccagacagcac
ggaacactcagggctgcactgatcgtcggaagtggagaccatgaacatgcgatcgctctg
gcacgggccgtacctccaatctcaaaccaggctctgatcccacgggtctcctgcaaagag
gcatacagggttcctggtccaggaaggaagattgcggtgatcgatctcgggatcaaacgg
catatggtcatcagcctgaataaacggggtgctgatctcgggatattcccatacaacaca
actgctgaggagatcgaggcctttgaacccgatgcactgctcatctccaacggaccaggg
gatccaatgcaggccagggatgcgatcaagaccgtctcatacctgatcgggaccatgcca
gtctttgggatctgcatgggaaatcaggtgaccgcgctggcgctgggagctgagacccat
aaactgaagttcggtcatcgtggcaccaatcagccggtaaggtacctggatgggaggatt
tttatcaccacccagaaccacggcttcgtcgtagaccaggagtccctccctgaggggtgt
acctgtagttataccaatttaaacgacggaaccctagaagggtttgaatcctcagaccta
gaaatctcctgcgttcaattccatcccgaggcccatggcggtccccgggatacagagagt
cacttttttgatatgattatgcggaggatagcctga

DBGET integrated database retrieval system