KEGG   Candidatus Methanosphaerula palustris: Mpal_2344Help
Entry
Mpal_2344         CDS       T00823                                 

Definition
methyl coenzyme M reductase system, component A2
Orthology
K00400  
methyl coenzyme M reductase system, component A2
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Mpal_2344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2488014..2489609)
Genome map
AA seq 531 aa AA seqDB search
MPKPFISVHDLCMDFGNTRVLNGVSFEIQEGEIIGVIGRSGAGKSVLMHLLRGVEQPPTQ
GSIVYHMVGCDRCTFMDVQSRAGGRCPECGGKLVAVDVDLWDEKNDGMKSRVMNRTAIMF
QRTFALYGNDRVIENVLHALDDIRYPQERAVSRAADLIEQVKLSHRMMHIARDLSGGEKQ
RVVLARQLAKNPAMLFADEPTGTLDPETARQVHRMLTQAVQQNGMGMIVTSHFSQVIEDL
ANRAMLLVDGDIVAIGSPKKIIDSFAEDYHEIESSVPVKHGEKILTARDVEKRYISVDRG
VIRAVNGVSFEVSRGEIFGIIGKSGAGKTTLSRIIAGIIEPTGGELNMKVGEEWIDMTKP
GIEFRGRAKSYIGLLHQEYDLYPHRTVIDNLTDAIGLEFPKELAVRKAVVTLKMAGFTED
KSREILDRLPGHLSEGEKHRVALAQVMIREPRLVILDEPTGTMDPITKQDVKHSILHARD
EMDETFVVVSHDMDFVRDICDRLALMRGGRIIEVGPTLDILGEMTDDEKSE
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaccattcatcagtgtacatgacctctgcatggacttcgggaatacacgagtc
ttaaatggggtctcgttcgagatccaggaaggggagattattggtgtcatcggaaggagc
ggggctggtaagagcgtgctgatgcacctcctccggggggttgaacaaccaccgacccaa
ggctctattgtctaccacatggtgggatgtgatcgctgtacattcatggacgtccagagc
cgggccggcgggagatgcccagaatgcggggggaagctcgtggccgtcgacgtcgatctc
tgggatgagaagaacgacggtatgaagtcccgggttatgaaccgaaccgccatcatgttc
cagcggacgtttgccctctatggtaatgaccgggtcattgagaacgtactccacgccctc
gacgacatccgttaccctcaggagcgtgcggtcagtcgagcggccgacctcatcgaacag
gtgaaactctcgcaccggatgatgcatatcgcccgtgatctctcgggtggcgagaagcag
cgggtggtcctcgcccggcagctcgcaaagaatccggcgatgctctttgccgatgaacca
acgggaacgctcgatcccgagacggctcggcaggtgcacaggatgctcacgcaagcagtg
caacagaacggaatgggtatgatcgtcacatcgcacttctcccaggtgatcgaggacctg
gcgaaccgtgcgatgctgctggtggatggagatatcgtcgcgatcggatccccgaagaag
atcatcgattcgtttgcagaggattaccatgagatcgaatcctcagtgcctgtgaaacat
ggcgagaaaatcctgacggcccgcgatgtcgagaagcgctacatctcggtggaccggggc
gtgatcagggctgtcaacggggtctcgttcgaagtctcacggggggagattttcggcatc
atcgggaagagtggggctggcaagaccactctttcacggatcatcgccggtattattgaa
cccacgggcggggagttgaatatgaaggtcggagaggagtggatcgatatgaccaaaccg
gggatcgagttccgtggcagggcgaagagttacatcgggctcctccaccaggagtacgac
ctttacccgcaccgaacggttatcgacaacctgaccgatgcgatcggactggagtttccg
aaagaattggcagtgcgcaaggcggtcgtgaccctgaagatggctgggttcaccgaggat
aagagcagggagatcctcgaccgcctgcccggtcacctcagcgagggggagaagcaccgg
gtcgccctcgcgcaggtaatgatccgggagccgcgcctggtaatccttgatgagccgacg
ggaacgatggatccgatcacaaaacaggatgtcaaacattcgatcctgcatgcccgcgat
gagatggatgagacgtttgtcgtcgtctctcatgacatggacttcgtccgggatatctgc
gaccgtctcgctctcatgcggggtggcaggatcatcgaagtcggaccgactctggatatc
cttggagagatgaccgacgatgagaagagtgagtga

DBGET integrated database retrieval system