KEGG   Candidatus Methanosphaerula palustris: Mpal_2409Help
Entry
Mpal_2409         CDS       T00823                                 

Definition
(GenBank) Cellulase
Organism
mpl  Candidatus Methanosphaerula palustris
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ACL17689
JGI: Mpal2409
UniProt: B8GEI8
Position
complement(2550638..2551684)
Genome map
AA seq 348 aa AA seqDB search
MVKKLLQQLSDAHGTSGNEESIYALIKKEITPYVDEILEDTMGNLIAVKHGDDFKVMLAA
HMDEIGLMVSYVDEKGFIRFVPIGGWYAPTLYNQRVLIHGKNGMIAGVVGGKPPHMMKDE
ERKRGVKIEEMFVDVGAASVEEVAALGIEIGDPVTVDRSFAELSNNRVSGKAFDNRAGVV
MLIKAMQRMKSPSTVYAVFTVQEEVGCKGAKTSAFGIDPDCAIATDVTIPGDHPGIEQKD
APVKMGKGPVVAIVEAGGRGVVAHKRMISWLRDAAEKAQIPVQFEVGSGGVTDASSIYLT
RAGIPCTSFSIPTRYIHSPVEVLDIADLEAAVDLLVEALKTRPDFSTH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaaactgttacagcaactatcagatgcccatggcacatcaggcaacgaagag
agtatctatgcattgattaagaaggagatcaccccctatgtcgacgagattctcgaagat
acgatgggcaacctgatagccgtcaaacatggcgatgacttcaaggtgatgctggccgcc
cacatggacgagatcgggctgatggtcagctatgtcgatgagaaggggttcatccggttc
gtcccgatcggcggctggtatgcccctaccctgtacaaccagcgggtcctgatccatgga
aagaacgggatgatcgccggcgtcgtcggtggcaagcctccgcatatgatgaaggacgaa
gaacggaaacggggcgtcaagatcgaggagatgttcgtcgatgtcggtgccgcatcggtt
gaggaggtcgcagctctcggaattgaaatcggtgacccggtcaccgtcgaccgttcgttt
gctgaattatcgaacaaccgtgtcagtggcaaggcctttgacaaccgggccggcgttgtg
atgctcattaaggccatgcagcggatgaagtccccgtccacggtctatgccgtattcacc
gtccaggaggaagtcggatgtaagggggcgaagaccagcgcctttgggatcgatcctgac
tgtgcaatcgccaccgacgtgacgatccccggagaccatcccggcatcgagcagaaggac
gccccggtgaagatgggcaaggggccggtcgtcgccatcgtcgaggcgggcggacggggt
gtagtcgcccataaacgaatgatctcatggcttcgggacgccgcagagaaagcccagatc
ccggtccagttcgaggttggaagtggcggagtgaccgacgcttcatctatctacctgacc
cgagctggcatcccctgcacctccttctcgatcccgacccggtatatccactccccggta
gaggtgctcgacatcgccgatctcgaggctgcggtcgatctcctggtcgaggcgctgaag
actcgtccggacttctccacccactaa

DBGET integrated database retrieval system