KEGG   Candidatus Methanosphaerula palustris: Mpal_2409Help
Entry
Mpal_2409         CDS       T00823                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mpal_2409
Enzymes [BR:mpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mpal_2409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2550638..2551684)
Genome map
AA seq 348 aa AA seqDB search
MVKKLLQQLSDAHGTSGNEESIYALIKKEITPYVDEILEDTMGNLIAVKHGDDFKVMLAA
HMDEIGLMVSYVDEKGFIRFVPIGGWYAPTLYNQRVLIHGKNGMIAGVVGGKPPHMMKDE
ERKRGVKIEEMFVDVGAASVEEVAALGIEIGDPVTVDRSFAELSNNRVSGKAFDNRAGVV
MLIKAMQRMKSPSTVYAVFTVQEEVGCKGAKTSAFGIDPDCAIATDVTIPGDHPGIEQKD
APVKMGKGPVVAIVEAGGRGVVAHKRMISWLRDAAEKAQIPVQFEVGSGGVTDASSIYLT
RAGIPCTSFSIPTRYIHSPVEVLDIADLEAAVDLLVEALKTRPDFSTH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaaactgttacagcaactatcagatgcccatggcacatcaggcaacgaagag
agtatctatgcattgattaagaaggagatcaccccctatgtcgacgagattctcgaagat
acgatgggcaacctgatagccgtcaaacatggcgatgacttcaaggtgatgctggccgcc
cacatggacgagatcgggctgatggtcagctatgtcgatgagaaggggttcatccggttc
gtcccgatcggcggctggtatgcccctaccctgtacaaccagcgggtcctgatccatgga
aagaacgggatgatcgccggcgtcgtcggtggcaagcctccgcatatgatgaaggacgaa
gaacggaaacggggcgtcaagatcgaggagatgttcgtcgatgtcggtgccgcatcggtt
gaggaggtcgcagctctcggaattgaaatcggtgacccggtcaccgtcgaccgttcgttt
gctgaattatcgaacaaccgtgtcagtggcaaggcctttgacaaccgggccggcgttgtg
atgctcattaaggccatgcagcggatgaagtccccgtccacggtctatgccgtattcacc
gtccaggaggaagtcggatgtaagggggcgaagaccagcgcctttgggatcgatcctgac
tgtgcaatcgccaccgacgtgacgatccccggagaccatcccggcatcgagcagaaggac
gccccggtgaagatgggcaaggggccggtcgtcgccatcgtcgaggcgggcggacggggt
gtagtcgcccataaacgaatgatctcatggcttcgggacgccgcagagaaagcccagatc
ccggtccagttcgaggttggaagtggcggagtgaccgacgcttcatctatctacctgacc
cgagctggcatcccctgcacctccttctcgatcccgacccggtatatccactccccggta
gaggtgctcgacatcgccgatctcgaggctgcggtcgatctcctggtcgaggcgctgaag
actcgtccggacttctccacccactaa

DBGET integrated database retrieval system