KEGG   Candidatus Methanosphaerula palustris: Mpal_2460Help
Entry
Mpal_2460         CDS       T00823                                 

Definition
(GenBank) MCP methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
mpl02020  Two-component system
mpl02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mpal_2460
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mpal_2460
Enzymes [BR:mpl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Mpal_2460
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mpal_2460
Two-component system [BR:mpl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mpal_2460
Bacterial motility proteins [BR:mpl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mpal_2460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest CheR PAS_10 PAS_4 CheR_N PAS PAS_9 IncA PAS_8 Fez1 BicD Spc7 Golgin_A5 Rootletin HSD3 Lebercilin HMMR_N Exonuc_VII_L Atg14 TPR_MLP1_2 IFT57 Leu_zip Med30 OmpH Snapin_Pallidin G10 IL12 DUF3584 LMBR1 CALCOCO1 ATG16 Mnd1 HAUS-augmin3 Macoilin GrpE Borrelia_P83 HemX APG6 DUF1664 V_ATPase_I GAS HAP1_N DUF812 5_nucleotid DUF4407 HOOK
Motif
Other DBs
NCBI-ProteinID: ACL17737
JGI: Mpal2460
UniProt: B8GEN6
Position
2593475..2596390
Genome map
AA seq 971 aa AA seqDB search
MNENTDSVPVDDAFPIVGVGASAGGLEALEQFLNGVPPKSGMAFVVVQHLDPTQPGMLPE
LLQRTTPMQVIQITDSLVIQPNCVYVIPPGHDLSLLHRTLFLLEPHAPRGLRLPIDFFFR
SLADDLHEKSIGVVLSGMGSDGTIGLRAIKEKGGLVIVQDPASAKFDGMPRSAIDARLAD
IVAPAEDLPEKILAFARHLPVTTEPEPQIESGAENAFDKIVILLRARTGHDFSLYKKNTV
NRRIERRMAIHQIERIATYVRFLQENPPELDLLFRELLIGVTNFFRDPAVWETLGDRVIP
DLITASPDGTTLRAWVAGCSTGEEAFSLAIVFREALGNQSPAKQCTLQIYATDLDTDAID
QARMGYYPETIATDITEERLDRFFVKEEKGYRVRKEIREMVVFAPQNIIMDPPFTRLDLL
SCRNLLIYLEPEIQRKLIPLFHYALNPGGVLILGTAESIGTFTDLFSSLDAKLRLYRKVQ
PPLPAPSVEFPTVFFPPTNGTVDPRPTQKPVVNLQSLADQVILQQYAPAAVLTSDTGDIL
YINGRTGRFLEPAAGKANWNIFAMARDGLRSELGGAFRHALLQEKPVALRGVRIVSEGVT
VHTDVTIQKLTEPSPLKGLVLIVLADVPPTPEAPVRVRHTGRREEMLDLKERLRQSEEDL
RITREEMQSSQEELKSTNEELQSTNEELQSTNEELTTSKEEMQSLNEELQTVNTELESRV
ADLSHVNDDMKNLLNSTNIATVFLDNQLNLRWYTAGMTKLVNLLPGDVGRPVTDIASDLF
YPDLIRDAGEVLRTLIPVETEVTVRDGHRFSVHITPYRTLENRIDGVVITFADITAFRRL
EQELSRARTYAEAIVATIREPLLVLDSEMHVVSANRSFFETFQVSQKEVEGRELSTLGDG
EWDIPELQRLLGTILPENAVFSDLRVDHIFPTIGRRLMLLNARRIITEGGNTELILLAFE
DVTDRVGADSP
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaacactgattcagtcccggtcgacgatgccttccccatcgtcggtgtaggt
gcgtctgccggcgggcttgaggcccttgagcagttcctgaatggtgtacccccaaagagc
ggcatggcctttgtggtcgtccagcacctcgacccgacccagccgggtatgctgcccgaa
ctgctgcagcgtaccaccccgatgcaggtcatccagatcacggactccctggtcattcaa
cccaactgtgtctacgtcatcccgccaggccatgacctctccctgctccaccgaaccctc
ttcctgctcgaaccgcacgccccacggggattgcgcctcccgatcgacttcttcttccgt
tccctggccgacgacctgcacgagaagagtatcggcgtcgttctgtctggcatgggctcc
gacggcacgatcggcctgcgagcgatcaaggaaaagggagggcttgtgatcgtccaggac
cccgcctccgcaaaattcgacggcatgccccggagtgccatcgacgcgaggctggccgac
atcgtcgcacctgccgaagacctgccggagaagatcctcgcattcgcccggcacctgcca
gtcaccaccgaaccggagcctcagatcgagtcaggggcagaaaatgcctttgacaagatc
gtcatcctgcttcgggcccgcaccgggcacgacttctccctgtacaaaaagaacactgtg
aaccggcgtatcgagcgacggatggcgatccaccagatcgagcggatcgccacctatgta
cggtttctccaggagaaccccccggaactcgacctgctcttcagggaactcctgatcggg
gtaaccaatttcttccgtgatccggccgtctgggaaacgctcggagaccgggtgatcccg
gacctcatcacagcctcgccggacggcactacgctcagagcttgggtggccggctgctca
accggcgaggaggccttctccctcgcgatcgtcttccgggaggccctcgggaaccagtcg
ccggcgaagcagtgtaccctgcagatctacgccaccgacctcgacacggatgccatcgac
caggcgcggatgggatactatcccgagacgatcgcgaccgatattacggaggagcgtctg
gaccggttctttgtcaaagaggagaagggataccgggtcagaaaggagatccgggagatg
gtggtctttgccccacagaacattatcatggacccgccgttcaccaggctcgatcttctc
agctgccggaacctgctgatctacctggaaccggagatccagcgaaaactgatccctctc
ttccactatgccctgaacccgggaggcgtgctgatcctcggcacggccgaatccatcgga
accttcaccgatctcttctcgtcgctcgatgccaaactcaggctgtaccgtaaggtccag
cctcccctgccagcaccatcggtcgaattccccactgtcttcttcccgcccaccaacggt
acagtcgatccgcgaccgacacaaaaaccggtggttaacctgcaatcgctggccgaccag
gtgatcctgcagcagtatgcacctgcggccgtgttgaccagtgataccggcgacattctc
tatatcaacgggcgaacagggcggtttctcgagccggcggccggaaaggccaactggaat
atcttcgccatggcccgcgacgggctgcgttccgaactgggaggtgcgttccgacatgca
ctcctacaggagaagccggtcgccctcagaggagtcaggatcgtgagtgagggggtgacc
gttcacacagacgtcacgattcagaaactcaccgagccctctcccctgaaggggctggtg
ctgatcgttctcgccgatgtgccacccactccggaagcgccggtgcgagtccgccacacc
ggccggcgcgaggagatgctggacctgaaggaaaggctccgccagagcgaagaggatctc
aggataacccgggaggagatgcagtcctcgcaggaggagttgaagtcgaccaacgaggaa
ctccagtcgaccaatgaagaactccagtcgaccaacgaggaactgaccacctccaaagag
gagatgcagtcgctcaacgaagaactccagaccgtcaacacagaactggagagccgggtc
gccgatctctcgcatgtgaatgacgacatgaagaacctgttgaatagcaccaacatcgcg
acggtcttcctcgacaaccagctcaacctgcggtggtacacagccgggatgacaaaactg
gtcaacctgctcccgggtgatgtgggccggccagtcacagacattgcgtccgacctcttc
tacccggacctgatcagggatgccggggaggtgctgcgaaccctcattcccgtggaaaca
gaggtcacagtcagggacggccaccgattctcggtccatatcacaccctaccggaccctc
gaaaacaggatcgatggcgtggtgatcacgttcgcggatatcacggccttccggagactg
gaacaggaactctccagggcccgcacctatgccgaggcgatcgtggcgacgatacgggag
ccgctgctcgtcctcgacagtgaaatgcacgtcgtgtcggcgaaccgctcgttcttcgag
acgtttcaggtctcacagaaggaggtcgagggccgcgaactctccacgctcggcgacggg
gaatgggacattcctgaacttcagcggctgctggggacgatcctgccggagaacgcagtc
ttcagtgacttacgggtcgaccatatcttcccgacgatcggacgacgcctgatgctgctc
aatgcccgccggatcatcaccgagggagggaatacggaactgattctgctcgcctttgag
gatgtgaccgatagagtgggagcggacagtccatga

DBGET integrated database retrieval system