KEGG   Candidatus Methanosphaerula palustris: Mpal_2716Help
Entry
Mpal_2716         CDS       T00823                                 

Definition
thiamine pyrophosphate TPP-binding domain-containing protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpal_2716
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpal_2716
   00020 Citrate cycle (TCA cycle)
    Mpal_2716
   00620 Pyruvate metabolism
    Mpal_2716
   00640 Propanoate metabolism
    Mpal_2716
   00650 Butanoate metabolism
    Mpal_2716
  Energy metabolism
   00680 Methane metabolism
    Mpal_2716
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mpal_2716
Enzymes [BR:mpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mpal_2716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2847120..2848001
Genome map
AA seq 293 aa AA seqDB search
MSELPKEEYLKKCTSACAGCSSTLCLRYVLKAAGPDTVLVVPACCTSVLQGIYPTTAMNV
PVYNVAFAAAAACASGMSTAFSATGKKTNVIAYAGDGGTVDIGIQALSGALERGTNFLYI
CYDNEAYGNTGMQRSGATPIGARTTTTPGGKLETKKDIDRIVAAHEPPYMATACSAYPQD
LYKKVKKALSIQGPKFIHILAPCPPGWRYPTEKTVELGKLAVRTGVWMLYEREAGKLTIN
GISKAAMKKPLPLEEYLSAQGRFKGISVEAIREMQLTLERNQRRLRNEEEGLC
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactaccgaaagaggagtacctgaagaaatgcacctctgcctgtgcagggtgc
agttctaccctctgcctccgttatgtcctgaaggccgcaggcccggacacggtgctggtg
gtccccgcatgctgtacgagcgtgctgcaggggatctacccgaccacggcgatgaacgtc
ccggtttacaatgtagcgtttgcagcggccgctgcgtgcgcttcagggatgagcacggcc
ttttcagccacaggcaaaaagaccaatgtgatcgcctatgccggcgacggcggaacggtg
gatatcgggatccaggcactatcaggggccctggagcgtgggacaaactttctctatatc
tgctacgataacgaagcatacggcaacaccgggatgcagcggtcaggggcgaccccgata
ggggccaggaccacgacgacccccggcggaaagctcgagaccaagaaggatatcgaccgg
atcgtcgctgcccacgaaccgccctatatggcgaccgcatgcagcgcctatccccaggat
ctatataaaaaggtgaagaaggcgctctcgatacaggggccgaagttcatccatatcctc
gctccatgccccccaggatggcggtaccccacagagaagacggtcgaactcggaaaactg
gccgtcaggaccggggtctggatgctgtacgagcgggaagcaggaaaactgacgatcaat
ggtatctccaaggccgcgatgaagaaaccgctcccccttgaggaatatctctctgcccag
ggcaggttcaagggtatctcggtggaggctatcagggagatgcaactcacgcttgaacga
aaccagcggcgcctccgtaatgaggaggaaggactatgctga

DBGET integrated database retrieval system