KEGG   Candidatus Methanosphaerula palustris: Mpal_2717Help
Entry
Mpal_2717         CDS       T00823                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
mpl00010  Glycolysis / Gluconeogenesis
mpl00020  Citrate cycle (TCA cycle)
mpl00620  Pyruvate metabolism
mpl00633  Nitrotoluene degradation
mpl00640  Propanoate metabolism
mpl00650  Butanoate metabolism
mpl00680  Methane metabolism
mpl00720  Carbon fixation pathways in prokaryotes
mpl01100  Metabolic pathways
mpl01120  Microbial metabolism in diverse environments
mpl01130  Biosynthesis of antibiotics
mpl01200  Carbon metabolism
Module
mpl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mpl_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpal_2717
   00020 Citrate cycle (TCA cycle)
    Mpal_2717
   00620 Pyruvate metabolism
    Mpal_2717
   00640 Propanoate metabolism
    Mpal_2717
   00650 Butanoate metabolism
    Mpal_2717
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpal_2717
   00680 Methane metabolism
    Mpal_2717
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mpal_2717
Enzymes [BR:mpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mpal_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ACL17981
JGI: Mpal2717
UniProt: B8GFU8
Position
2847995..2849107
Genome map
AA seq 370 aa AA seqDB search
MLTIATGNKAVASAAREAQPDVVAAYPITPQTEIVEQIANYVTDGSMRSQYIPVESEHSA
MAACIGASVTGARTFTATSSHGLLYMHEMLHWAAASRLPIVMANVNRALGPGWNTWAEHS
DAFSQRDTGWLQVYVATVQEAYDATLMAFRIAEHHDVLLPVMVNLDGFSLSHITQSLKTV
KLGDFIPPIDLPHRIDTTHPVGYGPMTGPDQYFKFRWDIERSMRDAVKVIADVESDFASR
FGRQYGQTEEYRCEDADVVLISMGTLGKEAEMAIDILRDEGIRAGGMRLRWFRPFPKLDL
AGREVVVIDRDYSFGFGGVLAHAIRSTCRTDLYSVIAGLGGQEVTYDDIAEFVRSRKIGT
EFWFGVTPDV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgatagcaaccggcaacaaagcagtggcctcagcggctcgtgaggcccagcct
gatgtcgtggctgcgtatccgatcacaccgcagaccgagatcgtcgaacagatcgcgaac
tacgtgaccgacggttcgatgagaagccagtacattccagtcgagagcgaacattctgcg
atggcagcctgcataggggcctcggtcaccggtgcccggaccttcacggcgaccagttca
cacgggctgctctacatgcacgagatgctccactgggcggcggcttcgcgcctcccgatc
gtgatggcaaatgtgaaccgtgcgctcggcccgggatggaacacctgggcggagcactcg
gacgccttctcacagcgggacaccggctggctgcaggtctatgtggccactgtgcaggag
gcctacgatgcgacgctgatggccttccggatagcagagcaccatgacgtgctgctaccc
gtgatggtgaacttggacgggttttcgctcagccacatcacgcagtcgctcaagacggtc
aagctcggggacttcatcccgccgatcgatctaccgcatcgaatcgataccacccacccg
gtcggctacggtccgatgacgggtcctgaccagtatttcaagttcagatgggacatcgaa
cgatcgatgcgcgacgcggtgaaggtgatcgctgatgtagagtccgatttcgccagccgg
tttggcaggcagtatgggcagaccgaggagtaccggtgtgaagacgcggatgtggtcctc
atctcgatgggaacactcggtaaggaggccgaaatggcgatcgatatcctcagagatgag
gggatcagggcaggggggatgcgtctccgctggttcagaccgttcccgaagcttgacctt
gccggccgggaggtcgtggtgatcgaccgcgactactcattcggattcggcggggtgctg
gcccatgcaatccgatcgacctgcaggacggatctctacagtgtgatcgccggcctcggt
ggccaggaggtcacctatgatgacatcgcagagtttgtcaggtccaggaaaatagggact
gaattctggtttggggtgacgccagatgtttga

DBGET integrated database retrieval system