KEGG   Candidatus Methanosphaerula palustris: Mpal_2717Help
Entry
Mpal_2717         CDS       T00823                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:mpl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mpl00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mpl00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mpl00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mpl00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mpl00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:mpl00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:mpl00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2847995..2849107
Genome map
AA seq 370 aa AA seqDB search
MLTIATGNKAVASAAREAQPDVVAAYPITPQTEIVEQIANYVTDGSMRSQYIPVESEHSA
MAACIGASVTGARTFTATSSHGLLYMHEMLHWAAASRLPIVMANVNRALGPGWNTWAEHS
DAFSQRDTGWLQVYVATVQEAYDATLMAFRIAEHHDVLLPVMVNLDGFSLSHITQSLKTV
KLGDFIPPIDLPHRIDTTHPVGYGPMTGPDQYFKFRWDIERSMRDAVKVIADVESDFASR
FGRQYGQTEEYRCEDADVVLISMGTLGKEAEMAIDILRDEGIRAGGMRLRWFRPFPKLDL
AGREVVVIDRDYSFGFGGVLAHAIRSTCRTDLYSVIAGLGGQEVTYDDIAEFVRSRKIGT
EFWFGVTPDV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgatagcaaccggcaacaaagcagtggcctcagcggctcgtgaggcccagcct
gatgtcgtggctgcgtatccgatcacaccgcagaccgagatcgtcgaacagatcgcgaac
tacgtgaccgacggttcgatgagaagccagtacattccagtcgagagcgaacattctgcg
atggcagcctgcataggggcctcggtcaccggtgcccggaccttcacggcgaccagttca
cacgggctgctctacatgcacgagatgctccactgggcggcggcttcgcgcctcccgatc
gtgatggcaaatgtgaaccgtgcgctcggcccgggatggaacacctgggcggagcactcg
gacgccttctcacagcgggacaccggctggctgcaggtctatgtggccactgtgcaggag
gcctacgatgcgacgctgatggccttccggatagcagagcaccatgacgtgctgctaccc
gtgatggtgaacttggacgggttttcgctcagccacatcacgcagtcgctcaagacggtc
aagctcggggacttcatcccgccgatcgatctaccgcatcgaatcgataccacccacccg
gtcggctacggtccgatgacgggtcctgaccagtatttcaagttcagatgggacatcgaa
cgatcgatgcgcgacgcggtgaaggtgatcgctgatgtagagtccgatttcgccagccgg
tttggcaggcagtatgggcagaccgaggagtaccggtgtgaagacgcggatgtggtcctc
atctcgatgggaacactcggtaaggaggccgaaatggcgatcgatatcctcagagatgag
gggatcagggcaggggggatgcgtctccgctggttcagaccgttcccgaagcttgacctt
gccggccgggaggtcgtggtgatcgaccgcgactactcattcggattcggcggggtgctg
gcccatgcaatccgatcgacctgcaggacggatctctacagtgtgatcgccggcctcggt
ggccaggaggtcacctatgatgacatcgcagagtttgtcaggtccaggaaaatagggact
gaattctggtttggggtgacgccagatgtttga

DBGET integrated database retrieval system