KEGG   Candidatus Methanosphaerula palustris: Mpal_2749Help
Entry
Mpal_2749         CDS       T00823                                 

Definition
uroporphyrinogen-III synthase-like protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mpl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2876572..2877255
Genome map
AA seq 227 aa AA seqDB search
MKIAITRLAGKEENDAARCNAFGHTSEAVSPLRAEVYADQIEAFVQAVTEGQFDCLFFTS
ALPAQLIGPHLNTWPRVVAIGPTTAATLQQHGIPAETLSMFYSREFVPYLGSWISMKTIG
IPRADVPNQALLDSITGAGGIPREFRCYGLVKTGEPLQTADAGAILFTSAMSYREARWTP
RPDLLVGAIGEVTADAVRAGGTPVDVIGDGSLEGFLTALNRFIEERS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgcaatcacccggcttgctggcaaggaagagaacgatgctgcccggtgcaat
gcattcggccacaccagtgaggccgtctccccccttcgggccgaggtgtacgccgaccag
atcgaagcgtttgtgcaggcggtcaccgagggacagttcgactgcctcttcttcaccagt
gccctgccagcccagttgatcgggcctcacctgaacacctggccgcgggtggtggcgatc
gggccgaccaccgcagcgacactccagcagcacgggatcccggcagagaccctctcgatg
ttctactcgcgagagttcgttccctacctgggctcctggatcagtatgaagacaatcggg
atcccgcgtgccgacgtcccaaaccaggctctcctcgattcgatcaccggagccggcggg
atcccgcgggagttccgatgctacgggctcgtgaagaccggagaacccctccagaccgct
gacgccggggcgatcctcttcaccagtgcgatgtcgtacagagaggcacgctggacaccc
cgcccggatctgctggtcggcgccatcggcgaggtgacggcggatgcggtcagggccggc
ggaacaccggtggatgtgatcggtgacggttccctagaggggttccttacggcactgaac
cgattcatagaggagcgatcatga

DBGET integrated database retrieval system