KEGG   Mycoplasma pneumoniae 309: MPNA3910Help
Entry
MPNA3910          CDS       T01712                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mpm  Mycoplasma pneumoniae 309
Pathway
mpm00010  Glycolysis / Gluconeogenesis
mpm00020  Citrate cycle (TCA cycle)
mpm00620  Pyruvate metabolism
mpm01100  Metabolic pathways
mpm01110  Biosynthesis of secondary metabolites
mpm01120  Microbial metabolism in diverse environments
mpm01130  Biosynthesis of antibiotics
mpm01200  Carbon metabolism
Module
mpm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPNA3910 (pdhC)
   00020 Citrate cycle (TCA cycle)
    MPNA3910 (pdhC)
   00620 Pyruvate metabolism
    MPNA3910 (pdhC)
Enzymes [BR:mpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MPNA3910 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: BAL21968
Position
complement(466201..467409)
Genome map
AA seq 402 aa AA seqDB search
MANEFKFTDVGEGLHEGKVTEILKKVGDTIKVDEALFVVETDKVTTELPSPYAGVITAIT
TNVGDVVHIGQVMAVIDDGAGAAAPAAPQPVSAPAPAPTPTFTPTPAPVTTEPVVEEAGA
SVVGEIKVSNSVFPIFGVQPSAPQPTPAPVVQPTSAPTPTPAPASAAAPSGEETIAITTM
RKAIAEAMVKSHENIPATILTFYVNATKLKQYRESVNGLALSKYNMKISFFAFFVKAIVN
ALKKFPVFNGRYDKERNLIVLNKDVNVGIAVDTPDGLIVPNIKQAQTKSVVDIAKDIVDL
ANRARSKQIKLPDLSKGTISVTNFGSLGAAFGTPIIKHPEMCIVATGNMEERVVRAEGGV
AVHTILPLTIAADHRWVDGADVGRFGKEIAKQIEELIDLEVA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgagtttaagttcaccgatgttggtgagggcttacatgagggtaaagtaact
gaaatcctcaaaaaagtgggcgatacgatcaaggtcgatgaagccctttttgtagtggaa
accgataaggtaaccaccgaacttccatccccttatgctggggttattaccgccattacc
actaatgttggtgatgtggtgcacattggtcaggtgatggccgttattgatgatggcgct
ggtgctgctgcacctgctgcgccccaaccagtatctgcaccagctcctgccccaacccca
acatttaccccaacaccagcacctgtaaccaccgaaccagtagtggaagaggcgggtgcc
tcggtagtgggtgaaattaaggtatcgaacagtgtgtttcctatttttggtgtgcagcca
agtgcgccccaaccaacaccagctcctgtagtacaacctacatccgctccaactcccact
ccagctccagcatctgcagcagcacctagtggtgaggaaacgattgcgatcacgacaatg
cgtaaagcaattgctgaagcaatggtgaaatcacacgaaaacattcccgctacgattctc
accttctatgttaacgctactaagttaaagcagtaccgtgagagtgttaacggcttagct
ttaagcaagtacaacatgaagatttccttctttgctttctttgttaaagcaattgttaat
gctttgaagaagtttcctgttttcaatggtcgttatgacaaggaacgcaacctaattgtg
ttaaacaaggatgttaacgtaggtattgccgtggacactcccgatggtctgattgtgcct
aacattaagcaagcacaaacgaagtcggtagtcgacattgccaaggacattgttgatctt
gctaaccgtgcccgcagtaagcaaattaagcttcctgatttaagtaagggaacgatctcg
gtaactaactttggttctttaggcgctgcttttggtaccccgattattaagcacccggaa
atgtgtattgtcgctaccggtaacatggaagaacgtgttgtgcgtgctgaaggtggggta
gccgttcataccatcctaccgttaacaattgctgccgaccaccgctgggtcgatggcgct
gatgtgggtcgttttggtaaggaaattgccaagcaaatcgaagaattaattgatttagaa
gtagcttag

DBGET integrated database retrieval system