KEGG   Mycoplasma pneumoniae 309: MPNA5350Help
Entry
MPNA5350          CDS       T01712                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mpm  Mycoplasma pneumoniae 309
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mpm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
651820..652440
Genome map
AA seq 206 aa AA seqDB search
MIASIFGKITFVGKRKIIVEANCISYWFNVKENHSFEKNLEKPRQVFCQIIKRMVTNQIL
EEGFAFNTLEEKEWFSKFIELNGIGSKTALNLLNNNLEEMRDYIKNSNYHALTKLTGSNS
KVARALLALELYDRDDGGKRIKPNTAMANDYDEMFDTLKSLGYKPQDIQNALSKIEIKPN
FDVSEVIAEVIKLMSFQNNEVTNKTA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgtcaatttttggaaaaattacctttgttggtaagcgaaaaattattgttgaa
gccaattgtatttcctattggtttaatgtgaaagaaaaccatagcttcgaaaagaacttg
gaaaaaccgcgccaggtcttctgtcagatcattaaaagaatggttacgaaccagatcttg
gaagagggctttgccttcaataccttagaggaaaaggaatggttttcgaagttcatcgaa
ctcaatggcattggtagtaaaactgctttaaacttgctcaataacaacctcgaggaaatg
cgtgattatattaaaaacagtaactaccatgccttgactaagttaactggttctaacagt
aaggtagctcgcgcattgctggcactggaactgtatgaccgagacgatggtggtaaacgg
attaaacccaacactgccatggccaatgactatgatgagatgtttgacaccttaaagtcg
ttgggctataaaccccaagatatccaaaacgctttgagcaaaattgaaattaaacctaac
tttgatgtaagtgaagtgattgctgaagtgattaagttaatgtctttccagaacaatgaa
gttacaaataaaaccgcctaa

DBGET integrated database retrieval system