KEGG   Mycoplasma pneumoniae 309: MPNA5350Help
Entry
MPNA5350          CDS       T01712                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mpm  Mycoplasma pneumoniae 309
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MPNA5350 (ruvA)
Enzymes [BR:mpm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MPNA5350 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
651820..652440
Genome map
AA seq 206 aa AA seqDB search
MIASIFGKITFVGKRKIIVEANCISYWFNVKENHSFEKNLEKPRQVFCQIIKRMVTNQIL
EEGFAFNTLEEKEWFSKFIELNGIGSKTALNLLNNNLEEMRDYIKNSNYHALTKLTGSNS
KVARALLALELYDRDDGGKRIKPNTAMANDYDEMFDTLKSLGYKPQDIQNALSKIEIKPN
FDVSEVIAEVIKLMSFQNNEVTNKTA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgtcaatttttggaaaaattacctttgttggtaagcgaaaaattattgttgaa
gccaattgtatttcctattggtttaatgtgaaagaaaaccatagcttcgaaaagaacttg
gaaaaaccgcgccaggtcttctgtcagatcattaaaagaatggttacgaaccagatcttg
gaagagggctttgccttcaataccttagaggaaaaggaatggttttcgaagttcatcgaa
ctcaatggcattggtagtaaaactgctttaaacttgctcaataacaacctcgaggaaatg
cgtgattatattaaaaacagtaactaccatgccttgactaagttaactggttctaacagt
aaggtagctcgcgcattgctggcactggaactgtatgaccgagacgatggtggtaaacgg
attaaacccaacactgccatggccaatgactatgatgagatgtttgacaccttaaagtcg
ttgggctataaaccccaagatatccaaaacgctttgagcaaaattgaaattaaacctaac
tttgatgtaagtgaagtgattgctgaagtgattaagttaatgtctttccagaacaatgaa
gttacaaataaaaccgcctaa

DBGET integrated database retrieval system