KEGG   Mycoplasma pneumoniae 309: MPNA6670Help
Entry
MPNA6670          CDS       T01712                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mpm  Mycoplasma pneumoniae 309
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MPNA6670 (gtaB)
   00052 Galactose metabolism
    MPNA6670 (gtaB)
   00500 Starch and sucrose metabolism
    MPNA6670 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    MPNA6670 (gtaB)
Enzymes [BR:mpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MPNA6670 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
790920..791795
Genome map
AA seq 291 aa AA seqDB search
MPKIRKAVIPAAGLGTRLLPATKAIPKEMLPLVNKPTIQYIVEEAVASGIKEILVIVSSK
KEAIIDHFDYDFILENALLQKHKDQEHQEIKDIANLAHIYFVRQKHQHGLGDAILHAKSF
VGNEDFAVLLGDDVVFGEQPALAQCIQAYEQTDCQVIGVQEVPHDQVNKYGIVTPEANWQ
KQALVKILGMVEKPAVNEAKSNLAILSRYILKPSIFTALKQVPFGVGGELQLTDGLNYCL
QQGEPFFAKHFGGTRFDVGTKNGFIKANLYTALKTDAITKDEVLAILKEFV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaaataagaaaagccgttattcccgcagccggactgggtaccagattactccca
gccactaaggccattcccaaagagatgttgcccttagtcaataaacccacaattcagtac
attgtggaagaagcagtagcgagtggcattaaggaaatcctagtaattgtgtcttctaaa
aaggaagcgattattgaccactttgactatgactttatcttggaaaatgctttactccaa
aagcacaaagatcaagaacaccaagaaattaaggatattgccaacttagcgcacatttac
tttgtccgccaaaaacaccaacacggtttaggagatgccattttgcacgccaagtcgttt
gttggtaacgaagactttgccgtccttttaggtgatgatgtcgtgtttggtgaacaaccg
gcattagcacaatgtattcaagcttatgaacaaacagattgtcaggtaataggcgtgcaa
gaagtgccccatgaccaggtcaacaagtatggcatagtaacccctgaagctaattgacaa
aaacaagcgttagtcaaaattttgggcatggtggaaaaaccagctgtcaacgaagccaag
agcaacctagccattttgagccgttacatccttaaacccagtatttttacagctcttaaa
caagtaccgtttggtgttggaggtgagttacagttgactgatgggttgaactattgttta
cagcaaggggaacccttctttgccaagcactttggtggtacccggtttgatgtcggtact
aaaaatggttttattaaagcgaacctgtacacggctttaaaaaccgatgccattactaag
gatgaagtcttggccatcctcaaggaatttgtttaa

DBGET integrated database retrieval system