KEGG   Mycoplasma pneumoniae M129: MPN050Help
Entry
MPN050            CDS       T00006                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mpn  Mycoplasma pneumoniae M129
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mpn00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(61977..63503)
Genome map
AA seq 508 aa AA seqDB search
MDLKQQYILALDEGTSSCRTIVFDKDLNQVAIAQNEFNQFFPKSGWVEQDPLEIWSVQLA
TMQSAKNKAQIKSNNIAAVGITNQRETIVLWNKENGLPVYNAIVWQDQRTASLCDKLNQD
TKIKEFVKKHTGLPINPYFSATKIAWILENVPLAQKMLKEDKLLAGTIDTWLIWKLTGGK
MHVTDVSNASRTLLFDITTMTWSQELGDIFKVPLSILPKVMPSNAHFGDIVPSHWSTSAT
GMVPIRGVAGDQQAALFGQLCVEPAMVKNTYGTGCFMLMNIGNELKYSQHNLLTTVAWQL
ENQKPVYALEGSVFVAGAALKWLRDSLKVMYSAAESDFYAKLAQKEEQEVVFVPAFTGLG
APYWDASARGAIFGIEANTKREHLVKATLEAIAFQANDLIKAMASDLNSSIKKIKADGGA
CNSNYLMQFQADIANLEVIIPKNVETTTMGAAFLAGLAVNYWKDTKQLEKLTGIAKQFKS
QMNQTVREKKSKRWNEAVKRTLKWASLD
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggatctaaaacaacaatacattcttgctctagatgaaggaaccagttcttgccgcacg
attgtgtttgacaaggatttaaaccaagtagcgattgcccaaaacgaatttaaccagttc
tttcctaagagtggttgggtcgaacaagatcccttagaaatttgatcagtccaattagct
acgatgcaaagtgctaaaaataaggcacaaattaaatcaaacaacattgctgctgtaggg
attaccaaccaacgggaaaccattgtgttatgaaacaaagaaaatggtttgcccgtttac
aatgcaatagtatggcaagatcaacgcactgctagtttgtgtgataagttaaaccaagac
accaagataaaggagtttgtcaagaaacacactggtttaccaattaacccttattttagt
gccactaagattgcttgaatcttggaaaatgttcctttagcgcaaaagatgcttaaggaa
gacaagttgttagccggtacaattgatacctggttaatttgaaaactaacgggtggtaag
atgcatgtaactgatgtaagtaatgcatcgcgtacgctcttgtttgacattaccaccatg
acatgatcacaagagttaggcgacatctttaaagtacctttatcaatcctacccaaagtg
atgccatccaatgcccactttggtgacatagtaccgagtcattgatctactagtgctact
ggtatggtacctattcgtggggttgccggtgaccaacaagcagccttgtttggtcagctc
tgcgtggaaccagcgatggttaaaaacacctatggtacaggttgttttatgttgatgaac
atcggtaacgaactgaaatactcccaacataacttattaacaactgtagcttggcagtta
gaaaaccaaaaaccggtgtatgccttagaaggtagtgtttttgtggctggcgcagcctta
aagtgattaagggatagtcttaaggtaatgtactcggcagctgaaagtgacttttatgct
aagctagcacaaaaggaagaacaggaagtggtgtttgtcccagccttcactggtttaggc
gcaccttactgggatgcttcagcaagaggcgccatctttgggatagaagctaataccaaa
agggaacatttagtaaaagctaccttggaagcaattgcctttcaagctaatgacctgatt
aaggcaatggctagtgatttaaacagttctattaaaaaaattaaggctgatggcggtgct
tgcaattccaactatttaatgcaatttcaagctgatattgctaacttagaggtgattatt
cctaagaatgtggaaaccactaccatgggtgcggccttcctagctggtttagcagttaat
tattgaaaggacactaaacaactagaaaaactaactggaatcgctaagcagttcaaaagt
caaatgaaccaaactgtgcgggaaaagaaatcaaagcgttgaaacgaagctgttaaaaga
acactaaaatgagctagcttagactaa

DBGET integrated database retrieval system