KEGG   Mycoplasma pneumoniae M129: MPN064Help
Entry
MPN064            CDS       T00006                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mpn  Mycoplasma pneumoniae M129
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MPN064 (deoA)
Enzymes [BR:mpn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MPN064 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
80414..81679
Genome map
AA seq 421 aa AA seqDB search
MNIVNLISKKQRGKALTETEINWFVHSVNNKSLADYQVSAFLMAVWFQGMNSKELFCLTK
AMVKSGESLHFNHHSKLSVDKHSTGGIGDKVSIALIPILTALDYSVAKLSGRGLGYTGGT
IDKLEAVGVKTDFTPTEAQNLLDQNDCFIIGQSEGIAPVDKVLYALRDTTATVDSLPLIA
SSVMSKKLAINNDYIFIDLKYGKGAFCKTKTMAKELAQYMYSIAKQFKRKLYIKLSDMNQ
VLGKTIGNALEVLEVVHFLKRNWTEVGADFIQLMEQIVTEILIETKRAPNKRAAVALYHA
TLEGEKPWQRFLKFIELQGSSWERFLDLKELFNPQYKAPVLASQSGTLSYTSPVDLAMVS
ISLGAGRMVKTDLIDPMAGIKLVKQANEVVKAGDTVLELYSSKPITPAHIEAAQHTIIIK
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgttaaccttattagtaaaaagcaacgcggcaaggcgttaacggaaacagaa
attaactggtttgtccattccgttaataacaaaagcttggccgattatcaggtcagtgcc
tttttaatggcagtgtgatttcaggggatgaattccaaggagttgttttgtctcaccaaa
gcgatggtgaaatcaggagagagcctccactttaaccaccacagcaagttaagtgttgac
aaacactccactggtggtattggtgacaaggtttccattgctttaattccaatcttaact
gccttagattacagtgtcgcaaaactgtcgggtcgtggtttgggctacactggtggcaca
attgacaaattggaagcagtgggagtaaaaacagattttacaccaacagaggcgcagaac
ttactagaccaaaatgactgctttattattggtcaaagtgagggcattgctcccgtagac
aaggtgttgtatgcactacgcgatactacggcaactgtggacagtctgcccttaattgct
tccagtgtcatgtcgaagaagttggcaattaacaacgactacatcttcattgaccttaag
tacggtaagggcgctttctgtaaaacgaagacgatggctaaagagctagcgcagtacatg
tacagtattgccaagcagtttaagcgcaaactctacattaaactaagtgacatgaaccag
gttttgggtaaaacgattggtaatgcgttagaggtcttggaagtagtgcacttcttaaaa
cggaattgaactgaagtgggtgctgactttattcagttgatggagcaaatagtcactgaa
atccttatagaaacaaaacgtgcaccaaacaaacgggcagctgtagcactttaccacgct
acattagagggcgaaaaaccatggcagcgttttttaaaatttattgagctgcaaggtagt
agttgggaacgttttttggatttaaaagagctgtttaatccccagtataaagcgccagtg
ttagcatctcaaagtggtactttgagctataccagtccggtggatttagccatggtctcg
attagcttaggtgctggtcgaatggttaaaacagatctgattgacccaatggcggggatt
aagttagtgaaacaagctaacgaagtggtaaaagctggggacacagtcttagaactttac
agctccaaaccaattacgcctgcccacatagaagctgcgcagcacaccattattattaag
cagtaa

DBGET integrated database retrieval system