KEGG   Mycoplasma pneumoniae M129: MPN302Help
Entry
MPN302            CDS       T00006                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mpn  Mycoplasma pneumoniae M129
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:mpn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPN302 (pfkA)
   01230 Biosynthesis of amino acids
    MPN302 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPN302 (pfkA)
   00030 Pentose phosphate pathway
    MPN302 (pfkA)
   00051 Fructose and mannose metabolism
    MPN302 (pfkA)
   00052 Galactose metabolism
    MPN302 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MPN302 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MPN302 (pfkA)
Enzymes [BR:mpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MPN302 (pfkA)
Protein phosphatases and associated proteins [BR:mpn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MPN302 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
355685..356671
Genome map
AA seq 328 aa AA seqDB search
MSPKTTKKIAILTSGGDAPGMNATLVYLTRYATSSEIEVFFVKNGYYGLYHDELVPAHQL
DLSNSLFSAGTVIGSKRFVEFKELKVREQAAQNLKKRQIDYLVVIGGDGSYMGAKLLSEL
GVNCYCLPGTIDNDINSSEFTIGFLTALESIKVNVQAVYHTTKSHERVAIVEVMGRHCGD
LAIFGALATNADFVVTPSNKMDLKQLESAVKKILQHQNHCVVIVSENIYGFDGYPSLTAI
KQHFDANNMKCNLVSLGHTQRGFAPTSLELVQISLMAQHTINLIGQNKVNQVIGNKANVP
VNYDFDQAFNMPPVDRSALIAVINKNII
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtccaaaaacaaccaaaaaaattgccattttaacctctggtggtgatgctccaggg
atgaatgccacactagtttacctaacgcgttatgccactagttctgaaattgaagttttc
tttgtgaaaaacggttattatgggctgtaccatgatgagttagtacccgctcatcaatta
gatttgtcaaacagcttgtttagtgctggcaccgtgattggtagtaagcgctttgtcgaa
tttaaggagttaaaggtccgcgagcaagcagcacagaatcttaaaaagcgccaaatcgat
tacctagtggttattggtggtgatggtagttacatgggcgctaaattgctaagcgagttg
ggcgttaactgttactgtttgccgggtacgattgacaacgacataaattcgagtgagttt
acaattggttttctcacggctttggagtcgattaaggtcaatgtccaggccgtgtaccac
actacgaaatcacatgaacgggtcgccattgtggaggtgatgggtcgccattgtggtgat
ttagccatttttggtgccttagccaccaatgctgactttgtggtgactcctagcaataaa
atggatttaaagcagctagaaagtgctgtcaaaaagatcttgcaacaccaaaaccactgt
gtggtgattgttagtgaaaacatctatggctttgatggttatccctcacttacagcgatc
aaacagcactttgatgctaacaacatgaagtgtaacctggtgtccttgggtcacacgcaa
cgcggatttgcccctaccagcctcgagttagtccaaattagtttaatggcgcaacacacg
attaacttaattggacaaaacaaggttaaccaggtcattggtaataaggccaatgtgccc
gttaactatgactttgatcaagcctttaacatgccaccggttgatcgcagcgctttaatt
gcagtcattaataaaaatattatttaa

DBGET integrated database retrieval system