KEGG   Mycoplasma pneumoniae M129: MPN321Help
Entry
MPN321            CDS       T00006                                 

Gene name
dhfr
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mpn  Mycoplasma pneumoniae M129
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MPN321 (dhfr)
   00670 One carbon pool by folate
    MPN321 (dhfr)
Enzymes [BR:mpn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MPN321 (dhfr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
381529..382011
Genome map
AA seq 160 aa AA seqDB search
MVKAIWAMDQNGLIGNGNSLPWRIKAELQHFRQTTLHQDVLMGSATYLSLPPVFSERNVY
ILTRNLNFNPPDKGCLTKVIHEYENFIQPYLHHPDKHLYICGGAQVYEQLIPRCDALIVS
TIFGKYTGDKYLKVDFSPFELTKEISFAEFKVAYYHKIAR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagcaatttgagcaatggatcaaaatgggttaattggtaacggtaacagtttg
ccctgaaggattaaagcggagttacagcactttcgccagaccacgttgcaccaagatgta
ttaatgggctcggctacctatctttccttaccgccggtgtttagtgagcgtaacgtttat
atcctcacccgtaacctcaactttaacccgcctgataagggctgtttgactaaagtaatc
catgaatatgaaaactttatccaaccttatttgcaccatcccgataaacacctctacatc
tgtggtggggcacaagtttatgaacagctcattccccggtgtgatgcgttaattgtctct
accattttcggtaaatacaccggggacaaatacctcaaagtggattttagtccctttgaa
ttgaccaaagagatcagttttgctgagtttaaggtcgcttactatcacaaaattgcacga
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system