KEGG   Mycoplasma pneumoniae M129: MPN380Help
Entry
MPN380            CDS       T00006                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mpn  Mycoplasma pneumoniae M129
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mpn03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
457147..457980
Genome map
AA seq 277 aa AA seqDB search
MPELPEVATVITELKSCVLNKPVKQVKVHLDKVLKNTNVKQLNDALVNHSFVDIKRRGKY
IIFCLSNGLFLVSHLRMEGKYFFEAKGSQFDLNHVLVEFLFQDGDQLNYHDTRQFGTFHL
FNRYQFENARELNKLALDPLDQEFNHQAIFNKGHKSNKKIKTFILDQTNISGIGNIYADE
ILFASKIHPETLAKNLNLSQYQLICQNATDILKKAVEMKGTTIGTFTFKKDHTGGYQHFL
KIHGKKGKQCQSCNTTIIKKKINGRGSYICEKCQIQR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactacctgaagttgccactgtaattaccgaacttaagagctgtgttttaaac
aaacctgtcaagcaagttaaggttcacttagacaaggtgttgaaaaatactaatgtcaag
cagcttaacgatgcgttagtcaaccacagctttgtggacattaagcgccgcggcaagtac
attattttttgtttaagtaacggtttgtttttagtgtcacacttacgcatggaaggcaaa
tatttctttgaagctaaaggcagtcagtttgacttaaaccatgttttagtcgagttttta
ttccaagatggtgatcaacttaactatcatgatacgcgtcaatttggtacctttcacttg
ttcaatagatatcagtttgaaaacgcacgtgaattgaacaaattagcactcgatccctta
gatcaggaatttaaccatcaagcgatctttaacaaaggccataagtccaacaagaagatt
aaaacctttattttagatcagaccaacattagcggtattggcaatatttacgctgatgaa
attttgtttgcaagtaagattcaccctgaaactttagctaaaaatttgaacttatcgcag
tatcagctaatttgtcaaaatgcaactgatattttaaagaaagcagttgaaatgaagggt
actaccattggcacttttacctttaaaaaagatcataccggtggttaccaacacttcttg
aaaattcatggcaaaaaggggaagcaatgtcaaagctgtaacaccactattattaagaaa
aagattaatggtcggggcagctatatttgtgaaaagtgtcaaatacagcgttaa

DBGET integrated database retrieval system