KEGG   Mycoplasma pneumoniae M129: MPN629Help
Entry
MPN629            CDS       T00006                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpn  Mycoplasma pneumoniae M129
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPN629 (tpiA)
   01230 Biosynthesis of amino acids
    MPN629 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPN629 (tpiA)
   00051 Fructose and mannose metabolism
    MPN629 (tpiA)
   00562 Inositol phosphate metabolism
    MPN629 (tpiA)
Enzymes [BR:mpn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MPN629 (tpiA)
Exosome [BR:mpn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MPN629 (tpiA)
  Exosomal proteins of bladder cancer cells
   MPN629 (tpiA)
  Exosomal proteins of melanoma cells
   MPN629 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(755782..756516)
Genome map
AA seq 244 aa AA seqDB search
MRTKYLIGNWKTNKDLHQALAFVEQFKQHPAKTKAVLGIAPVHVHLTEVNKVLPNNLLLL
AQDANFIASGSYTGTVSYTQLQDIKVNSVIIGHSERRKYFNETAQVINQKLKACLQAGML
VVLCIGETEGQPISFLKEDLTQVLQGIDLSLLKQLVIAYEPIWAIGTGKTATPEIANNTI
AQIRVYLSELYNKEIAQQTSILYGGSVAKDNIKELAQTEQIDGFLVGKASLDVNDFLVMA
QVYA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacgaaatacctaattggtaactgaaagacaaataaggatttacaccaagcgttg
gcctttgtggagcaatttaaacagcaccctgctaaaactaaggcggttttgggtattgcc
ccagtccacgtccacttaaccgaggtaaacaaagtcttgcctaataacctcttactgtta
gcccaagacgctaactttattgctagtggttcttacactggtacggtgagctatacccaa
ctgcaagacattaaggtcaacagtgtcattattggtcactcggaacggcgaaagtacttt
aacgaaacagcgcaagttattaatcaaaaactaaaagcctgtttacaagctggaatgtta
gtcgtgctctgtattggtgaaacggaaggtcaaccaattagttttctcaaagaagactta
acccaagtcttgcaaggcattgacctaagcttactcaaacagttagtgattgcttacgaa
ccaatttgagcaattggtacgggtaaaaccgctacaccggaaattgctaataacacaatt
gcccaaattcgcgtgtaccttagtgaactgtacaacaaggaaattgcccaacaaacctcg
attctctatggtggttcggttgctaaggacaacattaaggagttagcacaaaccgagcaa
attgatggctttttagtgggcaaggcatctttggatgtcaacgactttttagtaatggca
caagtatatgcataa

DBGET integrated database retrieval system