KEGG   Mycoplasma pneumoniae M129: MPN629Help
Entry
MPN629            CDS       T00006                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpn  Mycoplasma pneumoniae M129
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mpn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mpn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mpn00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mpn00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(755782..756516)
Genome map
AA seq 244 aa AA seqDB search
MRTKYLIGNWKTNKDLHQALAFVEQFKQHPAKTKAVLGIAPVHVHLTEVNKVLPNNLLLL
AQDANFIASGSYTGTVSYTQLQDIKVNSVIIGHSERRKYFNETAQVINQKLKACLQAGML
VVLCIGETEGQPISFLKEDLTQVLQGIDLSLLKQLVIAYEPIWAIGTGKTATPEIANNTI
AQIRVYLSELYNKEIAQQTSILYGGSVAKDNIKELAQTEQIDGFLVGKASLDVNDFLVMA
QVYA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacgaaatacctaattggtaactgaaagacaaataaggatttacaccaagcgttg
gcctttgtggagcaatttaaacagcaccctgctaaaactaaggcggttttgggtattgcc
ccagtccacgtccacttaaccgaggtaaacaaagtcttgcctaataacctcttactgtta
gcccaagacgctaactttattgctagtggttcttacactggtacggtgagctatacccaa
ctgcaagacattaaggtcaacagtgtcattattggtcactcggaacggcgaaagtacttt
aacgaaacagcgcaagttattaatcaaaaactaaaagcctgtttacaagctggaatgtta
gtcgtgctctgtattggtgaaacggaaggtcaaccaattagttttctcaaagaagactta
acccaagtcttgcaaggcattgacctaagcttactcaaacagttagtgattgcttacgaa
ccaatttgagcaattggtacgggtaaaaccgctacaccggaaattgctaataacacaatt
gcccaaattcgcgtgtaccttagtgaactgtacaacaaggaaattgcccaacaaacctcg
attctctatggtggttcggttgctaaggacaacattaaggagttagcacaaaccgagcaa
attgatggctttttagtgggcaaggcatctttggatgtcaacgactttttagtaatggca
caagtatatgcataa

DBGET integrated database retrieval system