KEGG   Mycoplasma pneumoniae M129: MPN629Help
Entry
MPN629            CDS       T00006                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpn  Mycoplasma pneumoniae M129
Pathway
mpn00010  Glycolysis / Gluconeogenesis
mpn00051  Fructose and mannose metabolism
mpn01100  Metabolic pathways
mpn01110  Biosynthesis of secondary metabolites
mpn01120  Microbial metabolism in diverse environments
mpn01130  Biosynthesis of antibiotics
mpn01200  Carbon metabolism
mpn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPN629 (tpiA)
   00051 Fructose and mannose metabolism
    MPN629 (tpiA)
   00562 Inositol phosphate metabolism
    MPN629 (tpiA)
Enzymes [BR:mpn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MPN629 (tpiA)
Exosome [BR:mpn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MPN629 (tpiA)
  Exosomal proteins of bladder cancer cells
   MPN629 (tpiA)
  Exosomal proteins of melanoma cells
   MPN629 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 877328
NCBI-ProteinID: NP_110318
UniProt: P78010
Position
complement(755782..756516)
Genome map
AA seq 244 aa AA seqDB search
MRTKYLIGNWKTNKDLHQALAFVEQFKQHPAKTKAVLGIAPVHVHLTEVNKVLPNNLLLL
AQDANFIASGSYTGTVSYTQLQDIKVNSVIIGHSERRKYFNETAQVINQKLKACLQAGML
VVLCIGETEGQPISFLKEDLTQVLQGIDLSLLKQLVIAYEPIWAIGTGKTATPEIANNTI
AQIRVYLSELYNKEIAQQTSILYGGSVAKDNIKELAQTEQIDGFLVGKASLDVNDFLVMA
QVYA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacgaaatacctaattggtaactgaaagacaaataaggatttacaccaagcgttg
gcctttgtggagcaatttaaacagcaccctgctaaaactaaggcggttttgggtattgcc
ccagtccacgtccacttaaccgaggtaaacaaagtcttgcctaataacctcttactgtta
gcccaagacgctaactttattgctagtggttcttacactggtacggtgagctatacccaa
ctgcaagacattaaggtcaacagtgtcattattggtcactcggaacggcgaaagtacttt
aacgaaacagcgcaagttattaatcaaaaactaaaagcctgtttacaagctggaatgtta
gtcgtgctctgtattggtgaaacggaaggtcaaccaattagttttctcaaagaagactta
acccaagtcttgcaaggcattgacctaagcttactcaaacagttagtgattgcttacgaa
ccaatttgagcaattggtacgggtaaaaccgctacaccggaaattgctaataacacaatt
gcccaaattcgcgtgtaccttagtgaactgtacaacaaggaaattgcccaacaaacctcg
attctctatggtggttcggttgctaaggacaacattaaggagttagcacaaaccgagcaa
attgatggctttttagtgggcaaggcatctttggatgtcaacgactttttagtaatggca
caagtatatgcataa

DBGET integrated database retrieval system