KEGG   Mycoplasma pneumoniae M129: MPN667Help
Entry
MPN667            CDS       T00006                                 

Gene name
gtaB
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mpn  Mycoplasma pneumoniae M129
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MPN667 (gtaB)
   00052 Galactose metabolism
    MPN667 (gtaB)
   00500 Starch and sucrose metabolism
    MPN667 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    MPN667 (gtaB)
Enzymes [BR:mpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MPN667 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
790153..791028
Genome map
AA seq 291 aa AA seqDB search
MPKIRKAVIPAAGLGTRLLPATKAIPKEMLPLVNKPTIQYIVEEAVASGIKEILVIVSSK
KEAIIDHFDYDFILENALLQKHKDQEHQEIKDIANLAHIYFVRQKHQHGLGDAILHAKSF
VGNEDFAVLLGDDVVFGEQPALAQCIQAYEQTDCQVIGVQEVPHDQVNKYGIVTPEANWQ
KQALVKILGMVEKPAVNEAKSNLAILSRYILKPSIFTALKQVPFGVGGELQLTDGLNYCL
QQGEPFFAKHFGGTRFDVGTKNGFIKANLYTALKTDAITKDEVLAILKEFA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaaataagaaaagccgttattcccgcagccggactgggtaccagattactccca
gccactaaggccattcccaaagagatgttgcccttagtcaataaacccacaattcagtac
attgtggaagaagcagtagcgagtggcattaaggaaatcctagtaattgtgtcttctaaa
aaggaagcgattattgaccactttgactatgactttatcttggaaaatgctttactccaa
aagcacaaagatcaagaacaccaagaaattaaggatattgccaacttagcgcacatttac
tttgtccgccaaaaacaccaacacggtttaggagatgccattttgcacgccaagtcgttt
gttggtaacgaagactttgccgtccttttaggtgatgatgtcgtgtttggtgaacaaccg
gcattagcacaatgtattcaagcttatgaacaaacagattgtcaggtaataggcgtgcaa
gaagtgccccatgaccaggtcaacaagtatggcatagtaacccctgaagctaattgacaa
aaacaagcgttagtcaaaattttgggcatggtggaaaaaccagctgtcaacgaagccaag
agcaacctagccattttgagccgttacatccttaaacccagtatttttacagctcttaaa
caagtaccgtttggtgttgggggtgagttacagttgactgatgggttgaactattgttta
cagcaaggggaacccttctttgccaagcactttggtggtacccggtttgatgtcggtact
aaaaatggttttattaaagcgaacctgtacacggctttaaaaaccgatgccattactaag
gatgaagtcttggccatcctcaaggaatttgcttaa

DBGET integrated database retrieval system