KEGG   Methylobacterium populi: Mpop_0008Help
Entry
Mpop_0008         CDS       T00760                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mpo  Methylobacterium populi
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mpo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8864..11047
Genome map
AA seq 727 aa AA seqDB search
MNAPVRPPDLDVLAGSVERVTFHSAETGFCVLKVHARGRRDLVPVVGHAPAIAAGEWLTA
AGRWTTDREHGLQFRAETLQVTPPTGIEGIERYLASGQMRGIGPMMAKRIVAAFGEAVFE
IIEAEPARLTEVEGIGRKRAARIVKGWAEQKAVREIMIFLHAHGVGTARATRIFRTYGGD
SLKVMAEDPYRLARDIRGIGFRTADSIALRLGLARDAPQRLAAGVSYALQKAMDEGHCGL
PVERLVRLAADLLEVAPDLVRVAAALVLREGREVVADTLRGEPCLFLKGLHGAERAIAMR
MVERATGAPPWPEIDFALARPWVEAKTGKTLSASQAEAVGLVLRSKLCVLTGGPGVGKTS
TLDAILRILTAKGVRVLLAAPTGRAAKRMAEQTGLEARTLHRLLEIDPRNGGFQRGEDNP
LDCDLLVIDETSMVDVPLMHAVLKAVPERAGLILVGDVDQLPSVGPGQVLADLIASGRVP
VARLTEIFRQAAQSRIVVNAHSINTGRMPVTAPKGEESDFYLVEIEDAEAGVETLIDLVT
RRIPRRFGLDPARDIQVLTPMIRGSLGSRNLNHALQRVLNPSPPAQVERFGWRFAPGDRV
METRNDYDRDVFNGDLGTVSAIDAEEEALVVDFDGRPVIYPFGELDTLVPAFATTIHKAQ
GSEYPAVVIPVVTQHRTMLARNLLYTGVTRGRRLVVLVGQRRAVGLAIREGAARRRWTKL
REWLETA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgccggtgcggccacccgacctcgacgtgttggcgggctcggtcgagcgcgtc
actttccacagcgccgagacgggattctgcgtcctgaaggtccatgcccgcggccggcgc
gatctcgtgccggtggtgggccatgcgccggccattgccgcgggcgagtggctgacggcg
gcgggccgctggaccacggatcgcgagcacggcctccagttccgcgccgagacgctccag
gtcacaccgccgaccggcatcgaggggatcgaacgttatctcgcctcggggcagatgcgc
ggcatcggcccgatgatggccaagcgcatcgtcgcggccttcggcgaggcggtgttcgag
atcatcgaggccgagcccgcccgcctcaccgaggtcgagggcatcggccgcaagcgcgcc
gcccgcatcgtcaagggctgggccgagcagaaggcggtgcgggagatcatgatcttcctg
cacgcccacggcgtcggcaccgcgcgggcgacccgcatcttccgcacctatggcggcgat
tcgctgaaggtcatggcggaggatccgtaccgcctcgcccgcgacatccgcggcatcggc
ttccgcacggcggattccatcgcactgcgcctcggcctcgctcgcgacgcgccgcagcgg
ctcgccgcgggcgtgtcctacgcgcttcagaaggcgatggacgagggccattgcgggttg
cccgtcgagcggctggtgcggctcgccgccgatctcctcgaagtggcgcccgacctcgtc
cgggtcgcggccgcgctcgtcctgcgtgagggccgcgaggtcgttgccgacaccctgcgc
ggcgagccctgcctgttcctgaagggactgcacggcgccgagcgcgccatcgccatgcgg
atggtcgagagggcgacgggagcgccgccctggccggagatcgatttcgccctcgctcgc
ccctgggtcgaggcgaagaccggcaagacgctctcggcctcgcaggccgaggcggtcggg
ctcgtgctgcgctcgaagctctgcgtgctcaccggcggtcccggcgtcggcaagacctcc
accctcgacgcgatcctgcgcatcctcacggccaagggcgtgcgcgtgctgctcgccgcg
cccaccggccgcgccgccaagcgcatggccgagcagaccgggctggaggcccgcaccctc
caccgcctgctggagatcgacccgcgcaacggcggcttccagcgcggggaggacaacccg
ctcgattgcgatctcctcgtcatcgacgagacctcgatggtcgacgtgccgctgatgcat
gccgtgctcaaggcggtgccggagagggccggcctgatcctcgtcggcgacgtcgatcag
ctgccctccgtcggccccgggcaggtgctcgccgacctgatcgcgtccggccgcgttccg
gtggcccgcctgaccgagatcttccgccaggcggcgcagagccggatcgtcgtcaatgcc
cacagcatcaacaccggccgcatgccggtcacggcgccgaagggggaggagagcgacttc
tacctcgtggagatcgaggatgccgaggcgggcgtggagacgctgatcgacctcgtgacc
cgccgcatcccgcgccgcttcggcctcgatccggcccgcgacatccaagtgctgacgccg
atgatccgcggctcgctcggcagccgcaacctcaaccacgccctccagcgcgtgttgaat
ccctcccccccggcgcaggtggagcgcttcggctggcgcttcgcccccggcgaccgagtg
atggagacccggaacgactacgaccgcgacgtgttcaacggcgatctcggcacggtgagc
gccatcgacgcggaggaggaggcgctcgtggtcgatttcgacggtcggccggtgatctac
ccgttcggcgaactcgacacgctggtgccggccttcgccacgacgatccacaaggcgcag
ggttcggaatacccggccgtggtgatcccggtggtcacgcagcaccgcacgatgctcgca
cgcaacctcctctataccggcgtgacccgcgggcgccgtctcgtcgtgctcgtgggtcag
cgccgggcggtcggcttggcgatccgcgagggcgcggcgcggcggcgctggaccaagctg
cgggaatggctcgagaccgcctga

DBGET integrated database retrieval system