KEGG   Methylobacterium populi: Mpop_0310Help
Entry
Mpop_0310         CDS       T00760                                 

Definition
(GenBank) MCP methyltransferase, CheR-type
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mpo  Methylobacterium populi
Pathway
mpo02020  Two-component system
mpo02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mpop_0310
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mpop_0310
Enzymes [BR:mpo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Mpop_0310
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mpop_0310
Two-component system [BR:mpo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mpop_0310
Bacterial motility proteins [BR:mpo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mpop_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheB_methylest HWE_HK PAS_10 CheR_N PAS_4 HisKA_2 CENP-F_leu_zip KASH_CCD IFT57 Jnk-SapK_ap_N Golgin_A5 Spc7 HIP1_clath_bdg Seryl_tRNA_N Reo_sigmaC IncA Tropomyosin DUF3450 TPR_MLP1_2 Mnd1 HMMR_N bZIP_1 Fez1 JIP_LZII Fmp27_WPPW Rootletin ATG16 APG6 Ax_dynein_light bZIP_2 DASH_Duo1
Motif
Other DBs
NCBI-ProteinID: ACB78491
JGI: Mpop0310
UniProt: B1ZH87
Position
329485..332934
Genome map
AA seq 1149 aa AA seqDB search
MEPDFPETARAEAPEARSGAGASVPRFAGPVVGIGASAGGLEALREMLSRAQAPTGMAFV
IVQHLDPNHESMLAQLLDRHTDLNVLQCEGSEHIEGDTVYIIPPGRGLAIQQGVLELTEF
VQPRGLRRPIDDFFLSLAVDQQANAACVILSGTGADGTTGLRAVKEHGGVCVVQQPETAR
YDGMPVSAVGTGLVDFVQPPGEIVNCLAAFFRRRGADTVDEQADLVADHVDDLCRVIRTA
VGHDFSGYKRTTLIRRVERRMHVLGIDAGRAYLARIRVDKSECDALFRDLLINVTRFFRD
AEMFEVLRERAIEPLLRNRDPDEDIRVWVPGCSSGEEAYSIAMLFAEAARRHDLPLAVQI
FATDIDERMLQIAREASYPAAALADIPGALRERYVVPHAERFTIASEIRDLIRFSSHSLV
KDPPFSRIDLLSCRNLLIYFDDRLQQSVLPLFHYAVRPGGYLFLGPSESVSRFEQLFPPI
DQHARLFERPPGSPKYPIDLPGHARRSEARRADDGRKAAPVADEMAAARRVLERYAPPSM
VLNEDGAIIAAYGRLSRYFDFPVTRTGGTSAITLARPGLRDVIGPLLRQTRDARKRVVVR
DVEVVSEYGVQQIELVCDPLPDATMLLVLRDAGAFRPSSDPDLVEMDAGGDHVEALEEEL
LRTRYKLRSTVEELETANEELKSSNEEMMSMNEELQSTNEELTTVNDELKTKIDQLTVAN
ADLRNFFESTDLAVVVLDRELRVRSFTGSATTIFPLQPSDRGRPLADVSTRLEGSEYLAD
ARAVCAGGPAIQRRVVTRDGARTLSLRVLPYRLQSASVDGATVVLTDITEALSLERQLAA
ERERLDLAIKAGGIGIWEYLPDEEAIVVDATAAAMLDLGLEGRHPLADLTARLPSENGRE
VRDAFAQAARGHGDFEARLHVRGDGHATRYVRSYGRLIVGSAPLRIIGVSIDVSPEHALT
ETRDLMLREMNHRVKNLFAIIGGMITAGARSQRDVATFAHDMRERIAALGRAHSLADHTT
DQGISDLTSLVGATLQPYRDHIPTTIEGPPVAIDWRYVSSLAMILHECATNSVKYGALGA
EDGRLSVTWEHRSEGLTLHWIERMTRRAAVNTGRGFGSSLIEMSLQQLQATVERYLDESR
YELTLVMPG
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggatttccctgaaacggcccgggccgaggcgcccgaggcgcgcagcggagcg
ggcgcgtccgtgccccgcttcgcaggtcccgtcgtcgggatcggcgcctcagcgggcggc
ctggaagccctgcgggagatgctgtcgcgcgcccaggcgccgaccggcatggccttcgtc
atcgtccagcacctcgatcccaatcacgagagcatgctggcgcagctcctggatcggcat
accgatctgaacgtgctgcaatgcgagggaagcgagcacatcgagggcgacaccgtctac
atcatcccccccggccgcgggctcgcgatccaacagggcgtgctcgaactcaccgagttc
gtgcagccgcgcgggctgcgccggcccatcgacgacttcttcctctcgctcgcggtcgat
cagcaggcgaacgctgcctgcgtgatcctgtcgggcacgggcgccgacggcaccaccggc
ctgcgggcggtcaaggagcacggcggcgtctgcgtggtgcagcagccggagaccgcccgc
tacgacggcatgccggtctcggccgtcggcaccgggctcgtggatttcgtccagccgccg
ggcgagatcgtgaactgccttgcggccttcttccgccgtcgcggcgcggacaccgtcgac
gagcaggcggacctggtcgccgaccacgtggacgacctgtgccgggtgatccgcaccgcg
gtcgggcacgatttttccggctacaagcgcaccacgctcatccgtcgagtcgagcggcgc
atgcacgtgctcggcatcgatgcaggccgcgcctacctcgcccgcatccgggtggataaa
tccgagtgcgacgcgctgtttcgcgacctgctcatcaatgtcacccgcttcttccgcgac
gcggagatgttcgaggtgctgcgcgagcgggcgatcgagccgctgctgcgcaaccgcgat
cccgatgaggacatccgggtctgggtgccgggctgttcgagcggcgaggaggcctattcc
atcgccatgctgttcgccgaggccgcgcgacgccatgacctgcccctcgcggtccagatc
ttcgccaccgacatcgacgagcgcatgctgcagatcgcccgcgaagcgagctatccggca
gccgcgctggccgacatcccaggcgccttgcgcgagcgctacgtggtgccccacgccgag
cgcttcacgatcgcctcggagatccgcgacctcatccgcttctccagccacagcctggtc
aaggacccgccgttctcgcgcatcgacctcctgtcctgccgcaatctgctgatctacttc
gacgaccgcctgcagcaatcggtgctgccgctgttccactacgcggtgcggccgggcggc
tacctcttcctcggcccatccgagagcgtcagccgcttcgagcagctcttcccgccgatc
gatcagcacgcacgcttgttcgagcggccgccgggctcgccgaaatacccgatcgacctt
cccggccacgcccgccgcagcgaagcgcgccgtgctgacgacgggcgaaaggccgcgccg
gttgctgacgagatggccgccgcccggcgtgtgctggagcgctacgcgccgccgagcatg
gtcctgaacgaggacggcgctatcatcgcggcctacgggcggctcagccgctacttcgac
ttccccgtcacccgcaccggcggcaccagcgcgatcaccctggcgcgtccgggcctgcgc
gacgtgatcggcccactgctgcggcagacccgcgacgcgcgcaagcgcgtcgtggtgcgc
gacgtggaggtggtatcggaatacggcgtccagcagatcgaactcgtctgcgatccgctg
ccggatgccaccatgctcctggtgctgcgcgacgcgggcgccttccgcccgtcgagcgac
cccgacctcgtcgagatggatgccggcggagaccacgtcgaggcgctggaagaggagctg
ctgcgcacccgctataagctgcgatcgaccgtcgaggagctggagacggccaacgaggag
ctgaagagttccaacgaagaaatgatgtcgatgaacgaggagctccaatcgaccaacgag
gagctgaccacagtcaacgacgagctgaagaccaagatcgatcagctcaccgtcgccaac
gccgacctacgcaacttcttcgaatcgaccgacctcgccgtggtggtgctcgatcgtgag
ctgcgcgtgcgcagcttcaccggctcggccactacgatcttcccgctccagccaagcgac
cgcgggcgcccgctcgcggacgtctccacgaggctcgaaggctcggaatacctcgccgat
gcgcgcgcggtgtgcgcgggcggcccggcgatccagcggcgggtcgtgacccgcgacggc
gcgcgcaccttgtcgctgcgggtgctgccctaccgcctccagagcgccagcgtcgacggc
gccaccgtggtgctgaccgacatcaccgaggcgctctcgctggagcgccagctcgccgcc
gagcgcgaacggctcgacctcgcgatcaaggccggcgggatcggcatctgggagtacctg
cccgacgaggaggccatcgtggtcgatgccaccgctgcggccatgctcgatctcgggctg
gaagggcgccatccgctggcagatctcaccgcgcggctgccgtccgagaatggccgggag
gtgcgggacgccttcgcccaggccgcccgcggacacggtgacttcgaggcgcggctgcac
gtccgcggcgacgggcacgctacccgctacgtccgcagctacgggcggctcatcgtcggc
agcgcgccactgcggatcatcggcgtctctatcgacgtgtcacccgagcacgccctgacc
gagactcgcgacctgatgcttcgcgagatgaatcatcgagtcaagaacctgttcgcgatc
atcggcgggatgatcaccgcgggcgcccgctcgcagcgggacgtggcaaccttcgcccat
gacatgcgtgagcgcatcgccgcactcggacgcgcccactcgttggccgaccacaccacc
gaccaggggatcagcgatctcaccagcttggtcggcgcgaccctgcagccctaccgcgac
cacatcccgaccacgatcgaaggccctccggtggccatcgactggcgctacgtctcctcg
ctcgccatgatcctgcacgaatgcgcaacgaattcggtgaagtacggggcgctgggcgcg
gaagatggccggctttcagtgacctgggagcaccggtccgagggattgaccctgcactgg
atcgagcggatgacgcgccgtgccgcagtgaataccggccgtggattcggctcgtcgctg
attgagatgtcgctccagcaactccaggccactgtcgagcgctacctcgacgaaagcaga
tacgagctcactcttgttatgccaggatga

DBGET integrated database retrieval system