KEGG   Methylobacterium populi: Mpop_0392Help
Entry
Mpop_0392         CDS       T00760                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mpo  Methylobacterium populi
Pathway
mpo00480  Glutathione metabolism
mpo00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Mpop_0392
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mpop_0392
Enzymes [BR:mpo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Mpop_0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ACB78570
JGI: Mpop0392
UniProt: B1ZI84
Position
417197..417763
Genome map
AA seq 188 aa AA seqDB search
MTIRRRDCLAMLAVLAAGRANAPAYAAESGPAGAFAFDTPGGGTLPLSAYAGKPVLVVNT
ATACGYAPQFAGLQGLWTRFGDRGLTVIAVPSPDFGNQEPLDGAAIAEAARKNHGVTFPV
ADKTHVRGPAAHPFYRWAAEQKPGQSPQWNFHKYLVGRDGTLRAAFATQIDPSDPRIVSA
IVAELGQA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgacgattcgccgccgcgactgcctcgcgatgctcgccgttctcgccgcggggcgcgcc
aacgctcccgcctatgccgctgaatccggcccggcgggggccttcgcgttcgacacgccg
ggcggcggcacgctcccgctctcggcctatgccggcaagcccgtcctcgtcgtcaacacc
gccaccgcctgcggctacgctccgcaattcgccggcctccaggggctgtggacccgcttc
ggcgaccggggcctgacggtgatcgccgtgccctcccccgatttcggcaatcaggagccc
ctcgatggcgccgccatcgccgaggccgcacggaagaaccacggcgtcaccttcccggtg
gcggacaagacccatgtccgcggccccgccgcgcatccgttctatcgctgggcggcggag
cagaagccggggcagagcccgcaatggaacttccataaatatctcgtcggccgcgacggc
accctgcgcgccgccttcgcgacccagatcgatccgagcgatccgcgtatcgtcagcgcg
atcgtcgcggagctggggcaggcctga

DBGET integrated database retrieval system