KEGG   Methylobacterium populi: Mpop_0515Help
Entry
Mpop_0515         CDS       T00760                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mpo  Methylobacterium populi
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpop_0515
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mpop_0515
Enzymes [BR:mpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Mpop_0515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
554366..555295
Genome map
AA seq 309 aa AA seqDB search
MDSSPTIDLIGAPIEIGTSEPGAVMGPAALRTAGLTRVLHDLGFTVRDRGDLAPDCAVGQ
RDLPAIRAWMTEISRAVEMALDGGSLPLVAGGDHSLSLGSVDGVLRHCTRSGRPLFVLWL
DAHADFNTLETSPSGNVHGMPLAALCGEPGFDALFEGGERPLLDPRRVHLFGLRSIDTGE
RALVTQRQVNIVDMRTIDEFGVVAPLRRILDRVAAENGHLHASFDVDFLDPTIAPGVGTT
VPGGATFREAHLIMEMLCDSGLVGSLDVVELNPFLDERGRSARVLVELVASLFGRRIIDR
PTEMPPLEA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggattcgtcgccgacgatcgaccttatcggtgcgccgatcgagatcggaacgagcgag
ccgggcgcggtgatggggccggcggccctgcgcacggccggactgacgcgggtgcttcac
gatctgggcttcacggtccgcgaccggggcgacctcgcccccgactgcgcggtcggccag
cgcgaccttccggcgatccgcgcctggatgaccgagatttcgcgggcagtcgaaatggcc
ctggacggcggaagcctgccgctggtggcgggcggcgaccacagcctgtccctcggctcg
gtcgacggggtgctgcgccattgcacccgcagcggccggccgctcttcgtgctgtggctc
gacgcgcatgccgacttcaacacgctcgagacctcgccctcgggcaacgtccacggcatg
cctctggccgccctgtgcggcgaacccggcttcgacgcgctgttcgagggcggcgaacgc
ccgctgctcgacccgcgccgggttcacctgttcggcctgcgctccatcgataccggcgag
cgggctctggtgacgcagcggcaggtgaacatcgtcgatatgcgcaccatcgacgagttc
ggcgtggtggcgcccctgcggcgcatcctcgaccgggtggcggccgagaacggccacctg
catgcgagcttcgacgtggacttcctcgaccccaccatcgcaccgggcgtcggcaccacg
gtgccgggcggggcgacgtttcgcgaggcgcatctcatcatggagatgctgtgcgattcg
gggttggtcggctccctcgacgtggtggagctgaaccccttcctcgacgagcgcgggcgc
agcgcgcgggtgctcgtcgagctggtggcgagcctgttcggccgccgcatcatcgaccgg
ccgaccgagatgccgccgctggaggcctga

DBGET integrated database retrieval system