KEGG   Methylobacterium populi: Mpop_0538Help
Entry
Mpop_0538         CDS       T00760                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mpo  Methylobacterium populi
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mpop_0538
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mpop_0538
Enzymes [BR:mpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Mpop_0538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
580200..582635
Genome map
AA seq 811 aa AA seqDB search
MTEPTNPQGRTAPSSASLGDEELALIDRYWQAANYLSVGQIYLLDNPLLREPLQPQHIKA
RLLGHWGTTPGLNFIYVHLNRLIKARDLDAIYICGPGHGGPGIVANTYLEGHYSEIYPDI
AQDAEGMRRLFRQFSFPGGIPSHVAPETPGSIHEGGELGYAIVHAFGAVFDNPDLIAACV
IGDGEAETGPLAASWQSNKFLSPVTDGAVLPILHLNGYKIANPTVLGRMRDDELEALFTG
LGYEPFFVEGEAPEPMHRAMAETLDRAVARIKDIQAEARGGGMGFRRPRWPMIVLRSPKG
WTGPKTVDGKRVEGFWRAHQVPVGNARTDEGHRKVLEDWMRSYRPETLFDEAGRLRPELA
ALAPTGRRRMSANPHANGGLLRRELRCPRWQDFGLPVTKPGAEVGEATRTLGRYLRDVIR
LNAEARNFRIMGPDETASNRLDAVFEATDRVWIETIEPYDVGLAHEGRVMEVLSEHLCQG
WLEGYLLTGRHGLFSCYEAFIHIVDSMFNQHAKWLKVSRELGWRRPISSLNYLLTSHVWR
QDHNGFSHQDPGFIDLVANKKSDIVRVYLPPDANTLLWVADHCLKTYDRINVIVAGKQPQ
PQWLSAEEAGLHCEAGIGIWHWAGTDETGLEPDVVMACAGDVPTLETLAAVDLLKRAVPG
LRIRVVNVVDLMTLQSNRDHPHGLSDAEFDSLFTRDKPVIFAYHGYPYLIHRLTYSRVNH
ANLHVRGFIEEGTTTTPFDMVVLNELDRFHLAIEAIDRVPGLVTRAAQAKQGFRDRLTAH
KLYIREHGEDMPEIQGWKWPYETRRESGDRA
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagccaaccaatccgcaaggacggaccgcgccatcgtcggcgagcctcggcgac
gaggaactcgctttgatcgaccgctactggcaggcggccaactatctctcggtcggccag
atctacctgctcgacaacccgcttctgcgcgagccgctgcagccgcagcacatcaaggcg
cggctcctcggccattggggcacgacaccgggtctgaacttcatctacgtccacctgaac
cggctgatcaaagcgcgcgacctcgacgcgatctacatctgcggaccgggccatggcggc
cccggcatcgtcgccaacacctatctcgaaggccattacagcgagatctatccggacatc
gcccaggatgcggagggcatgcgccggctgttccggcagttctcgttccccggcggcatc
ccgagccacgtcgcgcccgagacccccggctcgatccacgagggcggcgaactcggctac
gccatcgtccacgccttcggcgcggtcttcgacaatcccgacctgatcgcggcctgcgtg
atcggtgacggcgaggccgagaccgggccgctcgccgcctcgtggcagtcgaacaagttc
ctcagcccggtcaccgacggcgcggtgctgccgatcctccacctcaacggctacaagatc
gccaacccgaccgtgctcggccggatgcgggacgacgaactcgaagccctgttcacgggg
ctcggctacgagcccttcttcgtcgagggcgaggcgcccgagccgatgcatcgggcgatg
gccgagacgctcgaccgtgcggtggcgcggatcaaggatattcaggccgaggcgcggggc
ggcggcatgggcttccggcgcccgcgctggccgatgatcgtgctgcgaagccccaagggc
tggaccgggccgaagaccgtcgacggaaagcgggtggagggcttctggcgcgcgcatcag
gtgccggtcggcaacgcccggaccgacgaggggcaccgcaaggtcctcgaagactggatg
cggagctatcgccccgaaaccctgttcgacgaggccggccgcctgcgccccgaactcgcc
gccctggcgcctacgggccgccggcgaatgagcgccaacccccacgccaatggtggcctg
ctacgccgggagctgcggtgtccccggtggcaggatttcggcctcccggtgaccaagccc
ggcgccgaggtcggcgaggcgacccgcaccctcgggcggtatctgcgcgacgtgatcagg
ctcaacgcggaagcgcgcaacttccgcatcatgggaccggacgagaccgcctcgaaccgc
ctcgacgcggtgttcgaggcgaccgaccgcgtctggatcgagaccatcgagccctacgac
gtcggcctcgcccacgaggggcgggtgatggaggtgttgagcgaacatctctgccagggc
tggctcgaaggctacctgctcaccggccgccacggcctgttctcctgctacgaggccttc
attcacatcgtcgattcgatgttcaaccagcatgccaagtggctgaaggtgtcccgcgaa
ctcggctggcgccggccgatctcgtccctcaactacctcctgacctcccatgtctggcgc
caggaccacaacggcttcagccaccaggatcccggcttcatcgacctcgtcgccaacaag
aagtccgacatcgtccgggtctacctgccgccggacgccaacaccctgctctgggtcgcc
gaccattgcctgaagacctacgatcgcatcaacgtgatcgtggccggcaagcagccgcag
ccgcaatggctcagcgccgaggaagcgggacttcactgcgaggccgggatcggcatctgg
cactgggccgggacggacgagaccgggctcgaacccgacgtcgtgatggcctgtgccggg
gacgtgccgacgctcgaaaccctggcggcggtcgatctgctgaaacgggcggtgccgggg
cttcgcatccgcgtcgtcaacgtggtcgacctgatgaccctgcaatcgaaccgggatcat
ccgcatgggctgagcgatgccgagttcgacagcctgttcacccgggataagcccgtgatc
ttcgcctatcacggctacccctatctcattcatcggctgacctattcccgggtcaaccac
gccaacctgcatgtgcgcggcttcatcgaggagggcaccacgacgacgcccttcgacatg
gtggtgctgaacgaactcgaccgcttccacctcgccatcgaggcgatcgaccgggtgccg
gggctggtgacgcgggcggcgcaggccaagcagggcttccgggaccggctgaccgcgcac
aagctctacatccgcgagcacggcgaggacatgcccgagatccagggatggaaatggccc
tacgagacccgccgggagagcggcgatcgggcctga

DBGET integrated database retrieval system